Glyma18g36160 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g36160

Feature Type:	gene_model
Chromosome:	Gm18
Start:	42503057
stop:	42508843
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g36160

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G48140	AT	Annotation by Michelle Graham. TAIR10: dolichol-phosphate mannosyltransferase-related \| chr1:17783402-17783914 FORWARD LENGTH=89	SoyBase	E_val: 4.00E-49	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0033185	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: dolichol-phosphate-mannose synthase complex	SoyBase	N/A	ISS
GO:0004582	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dolichyl-phosphate beta-D-mannosyltransferase activity	SoyBase	N/A	ISS
KOG4841	KOG	Dolichol-phosphate mannosyltransferase, subunit 3	JGI		ISS
PTHR16433	Panther	DOLICHYL-PHOSPHATE MANNOSYLTRANSFERASE POLYPEPTIDE 3	JGI		ISS
PF08285	PFAM	Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)	JGI		ISS
UniRef100_I1KZ46	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZ46_SOYBN	SoyBase	E_val: 8.00E-55	ISS
UniRef100_Q8LEQ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dolichyl-phosphate mannosyltransferase polypeptide 3 n=1 Tax=Arabidopsis thaliana RepID=Q8LEQ4_ARATH	SoyBase	E_val: 2.00E-46	ISS

Expression Patterns of Glyma18g36160

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g36160

Paralog	Evidence	Comments
Glyma08g46330	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g36160 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g167500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g36160

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma18g36160

Limit To All Plant Sequences

>Glyma18g36160.2   sequence type=transcript   gene model=Glyma18g36160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AACGATCTGGATTTCCTCAACTAGACTCTCGAGGATGGATCCGTGTCTCAAAAACGCACGTTTAGTGGCGAACTGAACAAACAAACCCTTGATCCGTCATTGTATTTGTAACCTCGAATCGAAGGAGAAGACGTCCCTTTTGTTTCTGCGACTACTCTCCAAGTCCGGTTTTGGTCTTCTCTCCTCTCCTATCTCACTCGCGATTGCGTTTATTCTTGTTTGGTGGAGGATTTCGCCCACTGTTCTGGTGAAGGGGAAGACCTCGCTCACTTGGACTTAAACGGTGCCTGGATCCTCAGAGTTCAGAATACGTTTTCAAGCTATTGATAAATGAAGCATATTGTGAAGATTTTGACATTGGTAATGGCCATTACTGCATTATGGGTTGGCCTTCTACAAACTTCTATGATTCCACGCAGCCATACTTGGTTGTTACCCATATATTTTGTTGTGTCTTTAGGATGTTATGGTCTTTTAATGGTTGGAATTGGTTTGATGAATTTTCCAACCTGTCCTCAAGAAGCTCTATTGTTGCAGAAGGACATTGTTGAGGCCAAGGAATATCTGCAACAAAAAGGAGTTGATGTTAGTTCCAGCTGATGCGGTCTCAAATCTCGCATGATGTTCTGAATTAGCTTATGACAATTACCTGATTGGGAGTTGCGAAAGATTTTTGGCTTTTAACTTCATACACAAAATACTGATATGGGAATTGCTTTCGATTTTGGCTTAATGTACATGAACTCTTTACTATAATCAATGGATAACTTTTTCTGTTGGTAGTTATTTTTTATTTTTTATTCATTTTTAAAATTTTGATTGCAAATT

Coding sequences of Glyma18g36160

Limit To All Plant Sequences

>Glyma18g36160.1   sequence type=CDS   gene model=Glyma18g36160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTGGCCTTCTACAAACTTCTATGATTCCACGCAGCCATACTTGTTACCCATATATTTTGTTGTGTCTTTAGGATGTTATGGTCTTTTAATGGTTGGAATTGGTTTGATGAATTTTCCAACCTGTCCTCAAGAAGCTCTATTGTTGCAGAAGGACATTGTTGAGGCCAAGGAATATCTGCAACAAAAAGGAGTTGATGTTAGTTCCAGCTGA

>Glyma18g36160.2   sequence type=CDS   gene model=Glyma18g36160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCATATTGTGAAGATTTTGACATTGGTAATGGCCATTACTGCATTATGGGTTGGCCTTCTACAAACTTCTATGATTCCACGCAGCCATACTTGGTTGTTACCCATATATTTTGTTGTGTCTTTAGGATGTTATGGTCTTTTAATGGTTGGAATTGGTTTGATGAATTTTCCAACCTGTCCTCAAGAAGCTCTATTGTTGCAGAAGGACATTGTTGAGGCCAAGGAATATCTGCAACAAAAAGGAGTTGATGTTAGTTCCAGCTGA

Predicted protein sequences of Glyma18g36160

Limit To All Plant Sequences

>Glyma18g36160.1   sequence type=predicted peptide   gene model=Glyma18g36160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGWPSTNFYDSTQPYLLPIYFVVSLGCYGLLMVGIGLMNFPTCPQEALLLQKDIVEAKEYLQQKGVDVSSS*

>Glyma18g36160.2   sequence type=predicted peptide   gene model=Glyma18g36160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKHIVKILTLVMAITALWVGLLQTSMIPRSHTWLLPIYFVVSLGCYGLLMVGIGLMNFPTCPQEALLLQKDIVEAKEYLQQKGVDVSSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain