SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g36100

Feature Type:gene_model
Chromosome:Gm18
Start:42423796
stop:42424179
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27450AT Annotation by Michelle Graham. TAIR10: adenine phosphoribosyl transferase 1 | chr1:9532421-9533807 FORWARD LENGTH=183 SoyBaseE_val: 3.00E-33ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006168GO-bp Annotation by Michelle Graham. GO Biological Process: adenine salvage SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009116GO-bp Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003999GO-mf Annotation by Michelle Graham. GO Molecular Function: adenine phosphoribosyltransferase activity SoyBaseN/AISS
PTHR11776Panther PHOSPHORIBOSYLTRANSFERASE JGI ISS
PF00156PFAM Phosphoribosyl transferase domain JGI ISS
UniRef100_B9R714UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenine phosphoribosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9R714_RICCO SoyBaseE_val: 1.00E-31ISS
UniRef100_I1K856UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K856_SOYBN SoyBaseE_val: 4.00E-34ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g36100.1   sequence type=CDS   gene model=Glyma18g36100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGAAGCTAGGGGCTTTATATTTGATTCATCCATTGCATTAGCTATTGGAGCAAAATTTGTCCCCATTAGGAAACCCAATAAATTGCCTGTTTTGTACTTCTTCAATGTGGTTATCTCAGAAGAGTATTCTTTGGAGTATGGAACAGACAAAATGGAGATGCATGTAGGGGCTGTACAACCTGGAGAACGAGCCTTAATCATAGATGATCTTATTGCCACGGGGGAACGTTAG

>Glyma18g36100.1   sequence type=predicted peptide   gene model=Glyma18g36100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VEARGFIFDSSIALAIGAKFVPIRKPNKLPVLYFFNVVISEEYSLEYGTDKMEMHVGAVQPGERALIIDDLIATGER*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo