Glyma18g36020 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g36020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g36020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g36020

Feature Type:	gene_model
Chromosome:	Gm18
Start:	42321334
stop:	42322577
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g36020

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G42470	AT	Annotation by Michelle Graham. TAIR10: Patched family protein \| chr1:15926987-15935128 FORWARD LENGTH=1272	SoyBase	E_val: 3.00E-45	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0008158	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hedgehog receptor activity	SoyBase	N/A	ISS
PTHR10796	Panther	PATCHED-RELATED	JGI		ISS
PTHR10796:SF35	Panther	NIEMANN-PICK C1	JGI		ISS
PF12349	PFAM	Sterol-sensing domain of SREBP cleavage-activation	JGI		ISS
UniRef100_B9H5I2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cholesterol transport protein n=1 Tax=Populus trichocarpa RepID=B9H5I2_POPTR	SoyBase	E_val: 5.00E-53	ISS
UniRef100_I1JSV1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSV1_SOYBN	SoyBase	E_val: 1.00E-67	ISS

Expression Patterns of Glyma18g36020

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g36020 not represented in the dataset	Glyma18g36020 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g36020 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g36020

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g36020

Limit To All Plant Sequences

>Glyma18g36020.1   sequence type=CDS   gene model=Glyma18g36020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAGGCATCTGCGTTCATCGTAACATATCCATTAAATAATGCTATTAATGAAGAAGGTAATGGAACCAGAAAGGCAGTTGCTTGGGAGAAGACCTTTATTCAGTTGGTGAAGGATGAGCTGTTACCGATGGTACAACCAAGAAATTTGACACTGGCTTTTTTATCTGAAAGCTCTATTGAGGAAGAATTGAAAGTTAGCTATCTTGTGATGTTTGCTTACATATCTCTTACTTTAGGGGATACCCTCCACCCTTTGTCTTTCTATATTTCATCTAAGGTGATGCTTGGTCTTTCAGGAGTAATTCTTGTTATGCTGTCTATCATTGGATCAGTTGGATTTTTTAGTGTGCTTGGTGTAAAATCTATTCTGATCATCATGGAAGTTATCCCATTTCTTGTCCTAGCC

Predicted protein sequences of Glyma18g36020

Limit To All Plant Sequences

>Glyma18g36020.1   sequence type=predicted peptide   gene model=Glyma18g36020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QASAFIVTYPLNNAINEEGNGTRKAVAWEKTFIQLVKDELLPMVQPRNLTLAFLSESSIEEELKVSYLVMFAYISLTLGDTLHPLSFYISSKVMLGLSGVILVMLSIIGSVGFFSVLGVKSILIIMEVIPFLVLA

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain