SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g35881

Feature Type:gene_model
Chromosome:Gm18
Start:42129103
stop:42130885
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g35881
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G06840AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat protein kinase family protein | chr1:2097854-2103208 REVERSE LENGTH=953 SoyBaseE_val: 9.00E-42ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007169GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane receptor protein tyrosine kinase signaling pathway SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF775Panther JGI ISS
PF00560PFAM Leucine Rich Repeat JGI ISS
UniRef100_G7K0W0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase-like protein n=1 Tax=Medicago truncatula RepID=G7K0W0_MEDTR SoyBaseE_val: 2.00E-41ISS
UniRef100_I1MBM2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MBM2_SOYBN SoyBaseE_val: 1.00E-51ISS

Expression Patterns of Glyma18g35881
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g35881 not represented in the dataset
Glyma18g35881 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g35881 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g35881
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g35881
>Glyma18g35881.1   sequence type=CDS   gene model=Glyma18g35881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCTCCGCAATCTGCCACAACCTCCATTGTGACCTCCGATACTTGCCGCAATCTCATCATGGACATTCCCTCTATTTCTTCCAGCTGCCTTTGGGCATTGTGCATCAACTTGATAACAATGACTTTGGCGGAAATAGCATTCCAGAATCTTATGGCAACATCTCAAAATTGTCAAAATTGAGCCTTAGGAACTACAGCTTGCAAGGACCAATTCCTGATTTCAGCAGGATACCACATCTTGCTTATCTTGACCTCAGTTTCAATCAGTTGAATGAATCAATTCCTACTAATAAGCTTTCCGACAATATCACAACCATTGACTTATCAAACAACAAGCTTACTGGAACAATTCCATCCAACTTTTCTGGTCTTCCACGTCTTCAGAAATTTCATTTGCAAACAATTCATTGA
Predicted protein sequences of Glyma18g35881
>Glyma18g35881.1   sequence type=predicted peptide   gene model=Glyma18g35881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSAICHNLHCDLRYLPQSHHGHSLYFFQLPLGIVHQLDNNDFGGNSIPESYGNISKLSKLSLRNYSLQGPIPDFSRIPHLAYLDLSFNQLNESIPTNKLSDNITTIDLSNNKLTGTIPSNFSGLPRLQKFHLQTIH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo