SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g35743

Feature Type:gene_model
Chromosome:Gm18
Start:41973285
stop:41974331
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g35743
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G22740AT Annotation by Michelle Graham. TAIR10: RAB GTPase homolog G3B | chr1:8049247-8050494 FORWARD LENGTH=203 SoyBaseE_val: 4.00E-30ISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0006913GO-bp Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010508GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of autophagy SoyBaseN/AISS
GO:0010623GO-bp Annotation by Michelle Graham. GO Biological Process: developmental programmed cell death SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0048102GO-bp Annotation by Michelle Graham. GO Biological Process: autophagic cell death SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF260Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_Q40211UniRef Annotation by Michelle Graham. Most informative UniRef hit: RAB7A n=1 Tax=Lotus japonicus RepID=Q40211_LOTJA SoyBaseE_val: 1.00E-31ISS
UniRef100_UPI000233F3D6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F3D6 related cluster n=1 Tax=unknown RepID=UPI000233F3D6 SoyBaseE_val: 7.00E-47ISS

Expression Patterns of Glyma18g35743
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g35743 not represented in the dataset
Glyma18g35743 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g35743 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g165800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g35743
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g35743
>Glyma18g35743.1   sequence type=CDS   gene model=Glyma18g35743   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACGACCCTGAAGTATTTCCCTTTGTATTACTTGGGAACAAGGTTGATATAGACAGTGGAAACAGTAGAAGGGTCACTGAGAAAAAAGCTAGAGACCGGTGTGCTTCCCGGGGAAACATACCATATTTTGAGACCTCTGCGAAAGAGGGCTACAACATTGAAGAGGCTTTTTCATGTGTTGCCAAAATTGCACTAGAATATGAACATGATCAAGACATGTGA
Predicted protein sequences of Glyma18g35743
>Glyma18g35743.1   sequence type=predicted peptide   gene model=Glyma18g35743   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNDPEVFPFVLLGNKVDIDSGNSRRVTEKKARDRCASRGNIPYFETSAKEGYNIEEAFSCVAKIALEYEHDQDM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo