SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g35450

Feature Type:gene_model
Chromosome:Gm18
Start:41747047
stop:41750645
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g35450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55160AT Annotation by Michelle Graham. TAIR10: small ubiquitin-like modifier 2 | chr5:22383747-22384772 REVERSE LENGTH=103 SoyBaseE_val: 1.00E-58ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0031386GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tag SoyBaseN/AISS
KOG1769 KOG Ubiquitin-like proteins JGI ISS
PTHR10562Panther UBIQUITIN-LIKE PROTEIN SUMO/SMT3-RELATED JGI ISS
PF11976PFAM Ubiquitin-2 like Rad60 SUMO-like JGI ISS
UniRef100_I1N263UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N263_SOYBN SoyBaseE_val: 1.00E-78ISS
UniRef100_Q8LSH9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-like protein SMT3 (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q8LSH9_PHAVU SoyBaseE_val: 4.00E-55ISS

Expression Patterns of Glyma18g35450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g35450
ParalogEvidenceComments
Glyma08g46500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g35450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g165200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g35450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g35450
>Glyma18g35450.1   sequence type=CDS   gene model=Glyma18g35450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGTATCAGGAGGCAGAGGAAGCCAGGAGGAGGAGAAGAAGCCTTCTGATCAAGGAGCACATATTAATCTCAAAGTCAAGGGCCAGGATGGCAATGAGGTTTTCTTTAGGATTAAAAGAAGCACTCAGCTCAAGAAACTGATGAACGCATACTGTGATCGTCAATCTGTAGATTTTAACTCAATTGCTTTCTTGTTTGATGGAAGGAGACTCCGAGCAGAACAGACCCCTGATGAGCTAGAGATGGAGGATGGTGATGAGATAGATGCAATGCTGCACCAAACCGGAGGTGGACATAAGTTTCTTCAAATGTATGATGATCATCTTCATCAAAATGCTTGA
Predicted protein sequences of Glyma18g35450
>Glyma18g35450.1   sequence type=predicted peptide   gene model=Glyma18g35450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSVSGGRGSQEEEKKPSDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGGHKFLQMYDDHLHQNA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo