|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G19140 | AT | Annotation by Michelle Graham. TAIR10: Aluminium induced protein with YGL and LRDR motifs | chr5:6423398-6425785 FORWARD LENGTH=222 | SoyBase | E_val: 1.00E-16 | ISS |
GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
GO:0010044 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to aluminum ion | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PF12504 | PFAM | Aluminium induced protein | JGI | ISS | |
UniRef100_I1MFF1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFF1_SOYBN | SoyBase | E_val: 2.00E-18 | ISS |
UniRef100_O64438 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ARG10 n=1 Tax=Vigna radiata RepID=O64438_VIGRA | SoyBase | E_val: 3.00E-17 | ISS |
Glyma18g35080 not represented in the dataset |
Glyma18g35080 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g35080.1 sequence type=CDS gene model=Glyma18g35080 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GGATGTTTCTACTCTACAGCAGTTGGAGGATTGAGATGCTATGAGAATCCAAAGAATAAGATTACTGCAGTACCTGCTGAGGAAGAGGAAATCTGGGGTGCATTCTTCAAG
>Glyma18g35080.1 sequence type=predicted peptide gene model=Glyma18g35080 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GCFYSTAVGGLRCYENPKNKITAVPAEEEEIWGAFFK
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||