|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G62950 | AT | Annotation by Michelle Graham. TAIR10: RNA polymerase II, Rpb4, core protein | chr5:25262447-25263033 REVERSE LENGTH=106 | SoyBase | E_val: 5.00E-29 | ISS |
| GO:0006351 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0044237 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular metabolic process | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0003899 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity | SoyBase | N/A | ISS |
| PTHR15561 | Panther | CALCITONIN GENE-RELATED PEPTIDE-RECEPTOR COMPONENT PROTEIN | JGI | ISS | |
| PF03874 | PFAM | RNA polymerase Rpb4 | JGI | ISS | |
| UniRef100_A8MS47 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase II, Rpb4, core protein n=1 Tax=Arabidopsis thaliana RepID=A8MS47_ARATH | SoyBase | E_val: 3.00E-26 | ISS |
| UniRef100_UPI000233F3C7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233F3C7 related cluster n=1 Tax=unknown RepID=UPI000233F3C7 | SoyBase | E_val: 1.00E-38 | ISS |
|
Glyma18g34923 not represented in the dataset |
Glyma18g34923 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.18g164000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g34923.1 sequence type=CDS gene model=Glyma18g34923 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAATCCAACGCTTAGAGGGCAATGCTGGTGCACTCACAAATTTTGAGGTCCTTGATTTCTTACGAGCTAAAGGAGCTTCAAAGGATCCAACAAGAGTTATTGCCAAAGTAGCACAGTCTGAATACAAGGTTTATGATTATTTGGTTGACACTGCTGCCTCTGTTCAAACAAGAGAGAGCATCAATGAGTTCTTGACAAGTGTTAAA
>Glyma18g34923.1 sequence type=predicted peptide gene model=Glyma18g34923 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKIQRLEGNAGALTNFEVLDFLRAKGASKDPTRVIAKVAQSEYKVYDYLVDTAASVQTRESINEFLTSVK
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||