|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G61670 | AT | Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3133) | chr3:22819052-22821870 FORWARD LENGTH=790 | SoyBase | E_val: 7.00E-12 | ISS |
GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
GO:0010050 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative phase change | SoyBase | N/A | ISS |
GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
GO:0016246 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA interference | SoyBase | N/A | ISS |
GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
UniRef100_I1NCJ1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NCJ1_SOYBN | SoyBase | E_val: 1.00E-35 | ISS |
UniRef100_Q654D6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Extra-large G-protein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q654D6_ORYSJ | SoyBase | E_val: 3.00E-09 | ISS |
Glyma18g34766 not represented in the dataset |
Glyma18g34766 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.18g163900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g34766.1 sequence type=CDS gene model=Glyma18g34766 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCGGACTCAGCCAACAAGTTGCGATTGGTGCGTTGCCCAAAGTGTCAAAATCTTCTTCTCGAACTCGCTGATTACTCTGTCTATCAATGTGGTGGCTGTGGTGCCGTTCTTCGAGCGAAGCATAAAGGTTATGTGAGTGGTAGCTTGTCGGATGAGGGGAAGGTTGGACTTGGAGGAGATTCTGGTAAATTAGAAAGTTCTTAG
>Glyma18g34766.1 sequence type=predicted peptide gene model=Glyma18g34766 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSDSANKLRLVRCPKCQNLLLELADYSVYQCGGCGAVLRAKHKGYVSGSLSDEGKVGLGGDSGKLESS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||