Glyma18g34485 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g34485): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g34485): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g34485

Feature Type:	gene_model
Chromosome:	Gm18
Start:	40495382
stop:	40496785
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g34485

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G09420	AT	Annotation by Michelle Graham. TAIR10: translocon at the outer membrane of chloroplasts 64-V \| chr5:2928316-2931750 FORWARD LENGTH=603	SoyBase	E_val: 4.00E-16	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0006820	GO-bp	Annotation by Michelle Graham. GO Biological Process: anion transport	SoyBase	N/A	ISS
GO:0006862	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0015696	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transport	SoyBase	N/A	ISS
GO:0015802	GO-bp	Annotation by Michelle Graham. GO Biological Process: basic amino acid transport	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0043269	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of ion transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0004040	GO-mf	Annotation by Michelle Graham. GO Molecular Function: amidase activity	SoyBase	N/A	ISS
GO:0016884	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbon-nitrogen ligase activity, with glutamine as amido-N-donor	SoyBase	N/A	ISS
PTHR11895	Panther	AMIDASE	JGI		ISS
PTHR11895:SF6	Panther	AMIDASE	JGI		ISS
UniRef100_B9SIP6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Amidase, putative n=1 Tax=Ricinus communis RepID=B9SIP6_RICCO	SoyBase	E_val: 1.00E-16	ISS
UniRef100_I1K2N1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2N1_SOYBN	SoyBase	E_val: 7.00E-24	ISS

Expression Patterns of Glyma18g34485

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g34485 not represented in the dataset	Glyma18g34485 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g34485 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g163700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g34485

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g34485

Limit To All Plant Sequences

>Glyma18g34485.1   sequence type=CDS   gene model=Glyma18g34485   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTGTTTTAGTCATTTTGGTTTTGCAGATCAGGCTCCAAAGCATTTGAATCTTTGTCAGTATATTGACTCTAGGGCGCCCAGTCTAAGGCTTCATCAGCAATCAACCCACCAACAAAATGAAACATCTGTATTGAAAACTCTTTCTTCAGATGATGGAATACTTGTTATTCCTACCATAGCAGGCAATCAACTAAAGCTTAATACAAAGAAAGGTGTTTCCTCAGAGTTCCATGACAGAACATTTGCATTATCGAGCATTGCTAGTGTATCTGGATGTTGTCAGGTTACAGTTCCATTAGGATAA

Predicted protein sequences of Glyma18g34485

Limit To All Plant Sequences

>Glyma18g34485.1   sequence type=predicted peptide   gene model=Glyma18g34485   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKCFSHFGFADQAPKHLNLCQYIDSRAPSLRLHQQSTHQQNETSVLKTLSSDDGILVIPTIAGNQLKLNTKKGVSSEFHDRTFALSSIASVSGCCQVTVPLG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain