SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g34362): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g34362): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g34362

Feature Type:gene_model
Chromosome:Gm18
Start:40382607
stop:40382990
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31350AT Annotation by Michelle Graham. TAIR10: glyoxalase 2-5 | chr2:13368451-13370802 FORWARD LENGTH=323 SoyBaseE_val: 1.00E-26ISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004416GO-mf Annotation by Michelle Graham. GO Molecular Function: hydroxyacylglutathione hydrolase activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR11935Panther BETA LACTAMASE DOMAIN JGI ISS
PTHR11935:SF7Panther GLYOXYLASE-RELATED JGI ISS
PF00753PFAM Metallo-beta-lactamase superfamily JGI ISS
UniRef100_D7LD21UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glyoxalase 2-5 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LD21_ARALL SoyBaseE_val: 6.00E-24ISS
UniRef100_I1MD50UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MD50_SOYBN SoyBaseE_val: 6.00E-28ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g34362 not represented in the dataset

Glyma18g34362 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g163500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g34362.1   sequence type=CDS   gene model=Glyma18g34362   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTGCTGGCCATGAGGTGCGTGTAATGGACACTCCTGGTCACACCCAAGGCCATATAAGCTTCTATTTTCCTGGATCTGGGGTAATTTTTACCGGAGACACTTTTTTCAACTTATCATGTGGCAAGCTCTTTGAAGGAACCCCACAGCAGGTTGTTTTAAATTGTACTTGTCCCTTTTTTCTTTTTTTTTTCTTTTAA

>Glyma18g34362.1   sequence type=predicted peptide   gene model=Glyma18g34362   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCAGHEVRVMDTPGHTQGHISFYFPGSGVIFTGDTFFNLSCGKLFEGTPQQVVLNCTCPFFLFFFF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo