Glyma18g34280 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g34280

Feature Type:	gene_model
Chromosome:	Gm18
Start:	40366953
stop:	40368037
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g34280

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G19140	AT	Annotation by Michelle Graham. TAIR10: Aluminium induced protein with YGL and LRDR motifs \| chr5:6423398-6425785 FORWARD LENGTH=234	SoyBase	E_val: 7.00E-17	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0010044	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to aluminum ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF12504	PFAM	Aluminium induced protein	JGI		ISS
UniRef100_I1M136	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M136_SOYBN	SoyBase	E_val: 5.00E-21	ISS
UniRef100_O64438	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ARG10 n=1 Tax=Vigna radiata RepID=O64438_VIGRA	SoyBase	E_val: 2.00E-19	ISS

Expression Patterns of Glyma18g34280

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g34280 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g34280

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g34280

Limit To All Plant Sequences

>Glyma18g34280.1   sequence type=CDS   gene model=Glyma18g34280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCTTTTGGCAAGTCACTTGCTTCTTTCCCTCGAGTTGGAGGATTGAGACGCTATGAGAATCCAAAGAATAAGATTATTGCAGTACCTGCTGAGGAAGAGGAAATCTGGGGTGCATTCTTCAAGGTGGAAGGGTCAGCAGTCCTTGCAGGCACAGAGTAA

Predicted protein sequences of Glyma18g34280

Limit To All Plant Sequences

>Glyma18g34280.1   sequence type=predicted peptide   gene model=Glyma18g34280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SFGKSLASFPRVGGLRRYENPKNKIIAVPAEEEEIWGAFFKVEGSAVLAGTE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain