SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g34280

Feature Type:gene_model
Chromosome:Gm18
Start:40366953
stop:40368037
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G19140AT Annotation by Michelle Graham. TAIR10: Aluminium induced protein with YGL and LRDR motifs | chr5:6423398-6425785 FORWARD LENGTH=234 SoyBaseE_val: 7.00E-17ISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0010044GO-bp Annotation by Michelle Graham. GO Biological Process: response to aluminum ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF12504PFAM Aluminium induced protein JGI ISS
UniRef100_I1M136UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M136_SOYBN SoyBaseE_val: 5.00E-21ISS
UniRef100_O64438UniRef Annotation by Michelle Graham. Most informative UniRef hit: ARG10 n=1 Tax=Vigna radiata RepID=O64438_VIGRA SoyBaseE_val: 2.00E-19ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g34280.1   sequence type=CDS   gene model=Glyma18g34280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCTTTTGGCAAGTCACTTGCTTCTTTCCCTCGAGTTGGAGGATTGAGACGCTATGAGAATCCAAAGAATAAGATTATTGCAGTACCTGCTGAGGAAGAGGAAATCTGGGGTGCATTCTTCAAGGTGGAAGGGTCAGCAGTCCTTGCAGGCACAGAGTAA

>Glyma18g34280.1   sequence type=predicted peptide   gene model=Glyma18g34280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SFGKSLASFPRVGGLRRYENPKNKIIAVPAEEEEIWGAFFKVEGSAVLAGTE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo