|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G25030 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G45410.3); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr4:12865336-12866638 FORWARD LENGTH=344 | SoyBase | E_val: 1.00E-12 | ISS |
GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
GO:0007165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: signal transduction | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
GO:0009723 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus | SoyBase | N/A | ISS |
GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
GO:0009753 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus | SoyBase | N/A | ISS |
GO:0009805 | GO-bp | Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process | SoyBase | N/A | ISS |
GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
GO:0030968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response | SoyBase | N/A | ISS |
GO:0035556 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction | SoyBase | N/A | ISS |
GO:0042538 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response | SoyBase | N/A | ISS |
GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
UniRef100_C6TDD4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TDD4_SOYBN | SoyBase | E_val: 1.00E-23 | ISS |
UniRef100_Q7XBR1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XBR1_ORYSJ | SoyBase | E_val: 3.00E-10 | ISS |
Glyma18g33510 not represented in the dataset |
Glyma18g33510 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g33510.1 sequence type=CDS gene model=Glyma18g33510 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAACGGAGATTTATCAAAGCACAAGGCACTTGGAAATGAATGGTTGGCAAAAGGAACTTGCCCAATTGCCAAGTCTTATAGAGCTGTAAGCAATGTTCTACCCATTGTTGCAACAGCTTTTCGGCCACCGAGTGGAGTGAAGCTTAAATATCTGTACCAGAAAAGTAAAGCAGATAAAATTGTAATGGATACAATCCACTCTACATATGGGGTTCCCATAAAAACAATTAGCAAAAATATCAAACTAGCCATAAACTCAGCAACTGGACATAGAAAAGATTACCTTTTGAGTCCGCTGGACTACTGGTATAAGCACTGCAATGTGCAACATTATAAAAGTGTAAATTGCTAG
>Glyma18g33510.1 sequence type=predicted peptide gene model=Glyma18g33510 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNGDLSKHKALGNEWLAKGTCPIAKSYRAVSNVLPIVATAFRPPSGVKLKYLYQKSKADKIVMDTIHSTYGVPIKTISKNIKLAINSATGHRKDYLLSPLDYWYKHCNVQHYKSVNC*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||