Glyma18g32900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g32900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g32900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g32900

Feature Type:	gene_model
Chromosome:	Gm18
Start:	38436717
stop:	38439968
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g32900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G13010	AT	Annotation by Michelle Graham. TAIR10: Oxidoreductase, zinc-binding dehydrogenase family protein \| chr4:7600682-7602567 FORWARD LENGTH=329	SoyBase	E_val: 1.00E-171	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
KOG1198	KOG	Zinc-binding oxidoreductase	JGI		ISS
PTHR11695	Panther	ALCOHOL DEHYDROGENASE RELATED	JGI		ISS
PTHR11695:SF34	Panther	gb def: hypothetical protein [pseudomonas stutzeri]	JGI		ISS
PF00107	PFAM	Zinc-binding dehydrogenase	JGI		ISS
PF08240	PFAM	Alcohol dehydrogenase GroES-like domain	JGI		ISS
UniRef100_G7L063	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Quinone-oxidoreductase-like protein n=1 Tax=Medicago truncatula RepID=G7L063_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1N1Z5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N1Z5_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g32900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32900 not represented in the dataset	Glyma18g32900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g32900

Paralog	Evidence	Comments
Glyma08g46150	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g32900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g158700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g32900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g32900

Limit To All Plant Sequences

>Glyma18g32900.1   sequence type=CDS   gene model=Glyma18g32900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAGAAACTCATGCATGCGGTTCAGTATGATAGCTACGGTGGAGGACCTGCTGGCTTAAAGCATGTTGAAGTTCCCATACCTACTCCCAGCAAAGATGAGGTTTTGATTAAGGTTGAAGCAGCTAGTATAAATCCATTTGATTGGAAAGTACAGAAACGCATGTTGTGGCCACTTTTGCCTCGCAAGTTCCCACATATACCTGGCACTGATATAACTGGAGAGGTCACAGAGGTTGGTCAAGGTGTCCAAAAGTTCAAACCTGGTGACAAAGTGGTAGCCATTGTTAACCCATTTAATGGCGGAGGACTGGCTGAGTTTGCGGTTGCTAAGGAGAGTGTCACTGCATCAAGACCATCAGAAACCTCAGCATCTGAATGTGCTGCCCTACCTGTAGCAGGTCTGACAGCTCTTCAAGCTCTCACCAAATCCATAGGGATAAAACTTGATGGGAGTGGTGAAAGGAAAAGCATTTTGGTCACTGCCGCATCAGGTGGTGTTGGTCACTATGCTGTCCAACTGGCAAAGCTAGGAAACACTCATGTGACAGCAACATGTGGAGCTCGCAATATTGAATTGGTGAAAAGTTTAGGGGCTGATGAGGTAATTGACTATAAGACCCCAGATGGCGCTGCTTTGAAGAGTCCATCTGGTAAGAAATATGATGCTGTGATTCACTGTGCAATGGGCTTTCCATGGTCCACCTTTGAGCCTAACTTGACCGTGACTGGAAAGGTTGTAGACATAACTCCAAGCTCTGCTTCAATGCTGACATTTGCTCTGAAAAAACTTACCTTCTCCAAAAAGCAACTTGTGCCTTTGCTTTTATTTCCTAAAGGTGAGGACCTTCAACATCTTATTCATTTAGTCAAGGAAGGAAAGCTTAAAACAGTTGTGGACTCCAAATATCCTCTAACCAAGGCTGAAGATGCCTGGGCTAAGAGTATTACTGGCCATGCAACTGGGAAGATAATTATTGAGTTCTAG

Predicted protein sequences of Glyma18g32900

Limit To All Plant Sequences

>Glyma18g32900.1   sequence type=predicted peptide   gene model=Glyma18g32900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKKLMHAVQYDSYGGGPAGLKHVEVPIPTPSKDEVLIKVEAASINPFDWKVQKRMLWPLLPRKFPHIPGTDITGEVTEVGQGVQKFKPGDKVVAIVNPFNGGGLAEFAVAKESVTASRPSETSASECAALPVAGLTALQALTKSIGIKLDGSGERKSILVTAASGGVGHYAVQLAKLGNTHVTATCGARNIELVKSLGADEVIDYKTPDGAALKSPSGKKYDAVIHCAMGFPWSTFEPNLTVTGKVVDITPSSASMLTFALKKLTFSKKQLVPLLLFPKGEDLQHLIHLVKEGKLKTVVDSKYPLTKAEDAWAKSITGHATGKIIIEF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain