SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g32871

Feature Type:gene_model
Chromosome:Gm18
Start:38341645
stop:38342043
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g32871
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17880AT Annotation by Michelle Graham. TAIR10: Chaperone DnaJ-domain superfamily protein | chr2:7767176-7767658 REVERSE LENGTH=160 SoyBaseE_val: 7.00E-24ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
PTHR25040Panther FAMILY NOT NAMED JGI ISS
PTHR25040:SF170Panther JGI ISS
PF00226PFAM DnaJ domain JGI ISS
UniRef100_P93499UniRef Annotation by Michelle Graham. Most informative UniRef hit: DnaJ-like protein (Fragment) n=1 Tax=Phaseolus vulgaris RepID=P93499_PHAVU SoyBaseE_val: 9.00E-53ISS
UniRef100_UPI000233834BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233834B related cluster n=1 Tax=unknown RepID=UPI000233834B SoyBaseE_val: 5.00E-60ISS

Expression Patterns of Glyma18g32871
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32871 not represented in the dataset
Glyma18g32871 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32871 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g158500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g32871
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g32871
>Glyma18g32871.1   sequence type=CDS   gene model=Glyma18g32871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTCTTCCGTGTCCTTTCTGTCTCTTCCCTTCGTTAACTTCTTCGACAACGCCATGGCTTCGTCGTCGTGCTGCGTCAAATCCTGGCCAATAGTCGCCTTCGCCACTGCTGAAGCTCGCTCTTCCTGGATGGAGCAACCGAGACCTTCGTATCTTAACTCCTCTTGCTCTTCGCCTTACGATATCCTTGGCATCCCCGTCGGCGCCTCTAACCAAGAAATCAAGGCCGCGTACCGGCGACTGGCCAGAGTTTGCCAAACCGATGTGGCGGCCATCGACCGAAAAAACTTGTCCGCTGACGAATTCATGAAGATCCACGCTGCATACTCTACTCTTTCTGATCCTAACATGTGTGCTAACTACGATTGGAGCCTATTCTGGCGACAACAGCAGTAG
Predicted protein sequences of Glyma18g32871
>Glyma18g32871.1   sequence type=predicted peptide   gene model=Glyma18g32871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MISSVSFLSLPFVNFFDNAMASSSCCVKSWPIVAFATAEARSSWMEQPRPSYLNSSCSSPYDILGIPVGASNQEIKAAYRRLARVCQTDVAAIDRKNLSADEFMKIHAAYSTLSDPNMCANYDWSLFWRQQQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo