|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G08040 | AT | Annotation by Michelle Graham. TAIR10: MATE efflux family protein | chr3:2566593-2569397 REVERSE LENGTH=526 | SoyBase | E_val: 2.00E-12 | ISS |
GO:0006826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: iron ion transport | SoyBase | N/A | ISS |
GO:0006855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: drug transmembrane transport | SoyBase | N/A | ISS |
GO:0006879 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular iron ion homeostasis | SoyBase | N/A | ISS |
GO:0010106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation | SoyBase | N/A | ISS |
GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
GO:0010413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process | SoyBase | N/A | ISS |
GO:0015706 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrate transport | SoyBase | N/A | ISS |
GO:0045492 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process | SoyBase | N/A | ISS |
GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
GO:0071281 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion | SoyBase | N/A | ISS |
GO:0071369 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to ethylene stimulus | SoyBase | N/A | ISS |
GO:0071732 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to nitric oxide | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
GO:0015137 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: citrate transmembrane transporter activity | SoyBase | N/A | ISS |
GO:0015238 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: drug transmembrane transporter activity | SoyBase | N/A | ISS |
GO:0015297 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: antiporter activity | SoyBase | N/A | ISS |
UniRef100_B2LUQ8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Aluminum-activated citrate transporter n=1 Tax=Glycine max RepID=B2LUQ8_SOYBN | SoyBase | E_val: 1.00E-17 | ISS |
UniRef100_I1M504 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M504_SOYBN | SoyBase | E_val: 1.00E-17 | ISS |
Glyma18g32728 not represented in the dataset |
Glyma18g32728 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.18g157600 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g32728.1 sequence type=CDS gene model=Glyma18g32728 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATCTTTGGGTTCTCAAAAGCTGAAAAACTCACTCACGAGCAACGTAGCGCGGCCGGAAGGTTTGATGTGAAGGAGTCAAGGTTTTCTATTATTAATGAGAGTCATCACTGTGTGACACTGGCTGCATCACTAGCTGCACAGCAGGGACCAACATCTATGGCTGCATTTCAAGTATGTCTGCAGGTTTGCAAAACAGTGGATAAAATAGCAATGATATCCGCTGGTGGTTTCATTGGAATTTGGGTTGCTTTGACCATCTATATGGGTCTTAGGGCATTTGCTGGCTTCTTGAGAATTGGAACGGGGTCAGGACCTTGGGAGTTCCTAAGGAGCTCATGA
>Glyma18g32728.1 sequence type=predicted peptide gene model=Glyma18g32728 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIFGFSKAEKLTHEQRSAAGRFDVKESRFSIINESHHCVTLAASLAAQQGPTSMAAFQVCLQVCKTVDKIAMISAGGFIGIWVALTIYMGLRAFAGFLRIGTGSGPWEFLRSS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||