Glyma18g32728 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g32728): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g32728): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g32728

Feature Type:	gene_model
Chromosome:	Gm18
Start:	38133818
stop:	38136389
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g32728

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08040	AT	Annotation by Michelle Graham. TAIR10: MATE efflux family protein \| chr3:2566593-2569397 REVERSE LENGTH=526	SoyBase	E_val: 2.00E-12	ISS
GO:0006826	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron ion transport	SoyBase	N/A	ISS
GO:0006855	GO-bp	Annotation by Michelle Graham. GO Biological Process: drug transmembrane transport	SoyBase	N/A	ISS
GO:0006879	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular iron ion homeostasis	SoyBase	N/A	ISS
GO:0010106	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0071281	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion	SoyBase	N/A	ISS
GO:0071369	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to ethylene stimulus	SoyBase	N/A	ISS
GO:0071732	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to nitric oxide	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0015137	GO-mf	Annotation by Michelle Graham. GO Molecular Function: citrate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015238	GO-mf	Annotation by Michelle Graham. GO Molecular Function: drug transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015297	GO-mf	Annotation by Michelle Graham. GO Molecular Function: antiporter activity	SoyBase	N/A	ISS
UniRef100_B2LUQ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aluminum-activated citrate transporter n=1 Tax=Glycine max RepID=B2LUQ8_SOYBN	SoyBase	E_val: 1.00E-17	ISS
UniRef100_I1M504	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M504_SOYBN	SoyBase	E_val: 1.00E-17	ISS

Expression Patterns of Glyma18g32728

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32728 not represented in the dataset	Glyma18g32728 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32728 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g157600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g32728

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g32728

Limit To All Plant Sequences

>Glyma18g32728.1   sequence type=CDS   gene model=Glyma18g32728   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTTTGGGTTCTCAAAAGCTGAAAAACTCACTCACGAGCAACGTAGCGCGGCCGGAAGGTTTGATGTGAAGGAGTCAAGGTTTTCTATTATTAATGAGAGTCATCACTGTGTGACACTGGCTGCATCACTAGCTGCACAGCAGGGACCAACATCTATGGCTGCATTTCAAGTATGTCTGCAGGTTTGCAAAACAGTGGATAAAATAGCAATGATATCCGCTGGTGGTTTCATTGGAATTTGGGTTGCTTTGACCATCTATATGGGTCTTAGGGCATTTGCTGGCTTCTTGAGAATTGGAACGGGGTCAGGACCTTGGGAGTTCCTAAGGAGCTCATGA

Predicted protein sequences of Glyma18g32728

Limit To All Plant Sequences

>Glyma18g32728.1   sequence type=predicted peptide   gene model=Glyma18g32728   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFGFSKAEKLTHEQRSAAGRFDVKESRFSIINESHHCVTLAASLAAQQGPTSMAAFQVCLQVCKTVDKIAMISAGGFIGIWVALTIYMGLRAFAGFLRIGTGSGPWEFLRSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain