SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g32680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g32680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g32680

Feature Type:gene_model
Chromosome:Gm18
Start:38103721
stop:38106510
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G59240AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S8e family protein | chr5:23902626-23903670 REVERSE LENGTH=210 SoyBaseE_val: 5.00E-123ISS
GO:0000462GO-bp Annotation by Michelle Graham. GO Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0006414GO-bp Annotation by Michelle Graham. GO Biological Process: translational elongation SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0042991GO-bp Annotation by Michelle Graham. GO Biological Process: transcription factor import into nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3283 KOG 40S ribosomal protein S8 JGI ISS
PTHR10394Panther 40S RIBOSOMAL PROTEIN S8 JGI ISS
PF01201PFAM Ribosomal protein S8e JGI ISS
UniRef100_I1N1Y6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S8 n=1 Tax=Glycine max RepID=I1N1Y6_SOYBN SoyBaseE_val: 1.00E-155ISS
UniRef100_I1N1Y6UniRef Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S8 n=1 Tax=Glycine max RepID=I1N1Y6_SOYBN SoyBaseE_val: 1.00E-155ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32680 not represented in the dataset

Glyma18g32680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g46070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g157300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g32680.1   sequence type=CDS   gene model=Glyma18g32680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTATTTCTAGGGATTCCATGCACAAGAGGCGTGCCACTGGTGGCAAGAAGAAGGCCTGGAGAAAGAAGAGAAAGTATGAGCTTGGGCGTCAGGCCGCAAACACCAAGTTATCAAGCAACAAAACTATCCGGAGGATTCGTGTTCGAGGTGGCAATGTTAAATGGAGGGCATTGAGGTTGGATACCGGCAATTACTCATGGGGTAGTGAAGCAGTTACTCGCAAGACTCGTATTCTAGATGTTGTTTACAATGCCTCAAACAATGAGCTTGTGCGAACTCAGACCCTGGTCAAGAATGCTATTGTTCAGGTTGATGCTGCTCCTTTCAAGCAGTGGTACCTTCAGCACTATGGTGTTGAAATTGGTAGAAAAAAGAAAGTGGCATCCAAGAAGGACTCTACTGAGGAGGGTGAGGCTGCTGCTGAAGAAACTAAGAAAAGTAACCATGTCCAGAGAAAACTTGAGAAACGCCAGAAAGATCGGAAACTTGACTCCCACATTGAAGAGCAATTTGGTGGTGGCCGATTGTTGGCCTGTATTTCTTCTCGTCCTGGACAATGTGGCAGGGCTGATGGGTACATTCTGGAAGGTAAGGAGCTGGAGTTTTACATGAAGAAACTCCAGAGGAAGAAGGGAAAGGGTGCTGCTTAA

>Glyma18g32680.1   sequence type=predicted peptide   gene model=Glyma18g32680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGVEIGRKKKVASKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRKLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKGAA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo