Glyma18g32650 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g32650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g32650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g32650

Feature Type:	gene_model
Chromosome:	Gm18
Start:	38046388
stop:	38047693
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g32650

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G50920	AT	Annotation by Michelle Graham. TAIR10: CLPC homologue 1 \| chr5:20715710-20719800 REVERSE LENGTH=929	SoyBase	E_val: 1.00E-38	ISS
GO:0006289	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide-excision repair	SoyBase	N/A	ISS
GO:0009658	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast organization	SoyBase	N/A	ISS
GO:0009902	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast relocation	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0010304	GO-bp	Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process	SoyBase	N/A	ISS
GO:0010380	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0019538	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein metabolic process	SoyBase	N/A	ISS
GO:0034660	GO-bp	Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process	SoyBase	N/A	ISS
GO:0042744	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process	SoyBase	N/A	ISS
GO:0042793	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0045037	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast stroma	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009532	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009706	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0031897	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Tic complex	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0004176	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP-dependent peptidase activity	SoyBase	N/A	ISS
GO:0004518	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nuclease activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
PTHR11638	Panther	ATP-DEPENDENT CLP PROTEASE	JGI		ISS
PTHR11638:SF19	Panther	gb def: atp-dependent clp protease atp-binding subunit [campylobacter jejuni]	JGI		ISS
UniRef100_B8ATF3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ATF3_ORYSI	SoyBase	E_val: 6.00E-37	ISS
UniRef100_Q7F9I1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chaperone protein ClpC1, chloroplastic n=2 Tax=Oryza RepID=CLPC1_ORYSJ	SoyBase	E_val: 9.00E-37	ISS

Expression Patterns of Glyma18g32650

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32650 not represented in the dataset	Glyma18g32650 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32650 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g32650

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g32650

Limit To All Plant Sequences

>Glyma18g32650.1   sequence type=CDS   gene model=Glyma18g32650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTGCTTGTTGCTGGAACTAAATATCGTGGTGAGTTTGAGGAGAGGTTGAAGAAACTGATGGAAGAAATCAAACAAATACTCTCCCATGACATGTTCAAAATGGATTTACTGCTTGTTGATTCTGACCTTGAATGTATTGGAGCCACAACATTAGACGAGTATAAGAAACACATTGAAAAAGATTCTGCTCTAGAGACACGGTTCCAGCTAGTTAAAGTGCCAGAGCCAACTGTAGATGAAACCATACAAATACTGAGAGGACTTAGAGATGATCAATTTTTGCCCGACAGAGCTATAGATTTGAATGATGAAGCTGGTTCACATAAGATAGAGTTATTAAATTCCATTTTTAGTTGGGAC

Predicted protein sequences of Glyma18g32650

Limit To All Plant Sequences

>Glyma18g32650.1   sequence type=predicted peptide   gene model=Glyma18g32650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLLVAGTKYRGEFEERLKKLMEEIKQILSHDMFKMDLLLVDSDLECIGATTLDEYKKHIEKDSALETRFQLVKVPEPTVDETIQILRGLRDDQFLPDRAIDLNDEAGSHKIELLNSIFSWD

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain