SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g32650

Feature Type:gene_model
Chromosome:Gm18
Start:38046388
stop:38047693
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g32650
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G50920AT Annotation by Michelle Graham. TAIR10: CLPC homologue 1 | chr5:20715710-20719800 REVERSE LENGTH=929 SoyBaseE_val: 1.00E-38ISS
GO:0006289GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide-excision repair SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010304GO-bp Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process SoyBaseN/AISS
GO:0010380GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019538GO-bp Annotation by Michelle Graham. GO Biological Process: protein metabolic process SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0045037GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast stroma SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009532GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009706GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0031897GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Tic complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0004176GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent peptidase activity SoyBaseN/AISS
GO:0004518GO-mf Annotation by Michelle Graham. GO Molecular Function: nuclease activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
PTHR11638Panther ATP-DEPENDENT CLP PROTEASE JGI ISS
PTHR11638:SF19Panther gb def: atp-dependent clp protease atp-binding subunit [campylobacter jejuni] JGI ISS
UniRef100_B8ATF3UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ATF3_ORYSI SoyBaseE_val: 6.00E-37ISS
UniRef100_Q7F9I1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chaperone protein ClpC1, chloroplastic n=2 Tax=Oryza RepID=CLPC1_ORYSJ SoyBaseE_val: 9.00E-37ISS

Expression Patterns of Glyma18g32650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32650 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g32650
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g32650
>Glyma18g32650.1   sequence type=CDS   gene model=Glyma18g32650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTGCTTGTTGCTGGAACTAAATATCGTGGTGAGTTTGAGGAGAGGTTGAAGAAACTGATGGAAGAAATCAAACAAATACTCTCCCATGACATGTTCAAAATGGATTTACTGCTTGTTGATTCTGACCTTGAATGTATTGGAGCCACAACATTAGACGAGTATAAGAAACACATTGAAAAAGATTCTGCTCTAGAGACACGGTTCCAGCTAGTTAAAGTGCCAGAGCCAACTGTAGATGAAACCATACAAATACTGAGAGGACTTAGAGATGATCAATTTTTGCCCGACAGAGCTATAGATTTGAATGATGAAGCTGGTTCACATAAGATAGAGTTATTAAATTCCATTTTTAGTTGGGAC
Predicted protein sequences of Glyma18g32650
>Glyma18g32650.1   sequence type=predicted peptide   gene model=Glyma18g32650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLLVAGTKYRGEFEERLKKLMEEIKQILSHDMFKMDLLLVDSDLECIGATTLDEYKKHIEKDSALETRFQLVKVPEPTVDETIQILRGLRDDQFLPDRAIDLNDEAGSHKIELLNSIFSWD






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo