SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g32630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g32630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g32630

Feature Type:gene_model
Chromosome:Gm18
Start:37970628
stop:37972021
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g32630
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G63620AT Annotation by Michelle Graham. TAIR10: GroES-like zinc-binding alcohol dehydrogenase family protein | chr5:25466380-25468296 REVERSE LENGTH=427 SoyBaseE_val: 2.00E-76ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0050897GO-mf Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding SoyBaseN/AISS
PTHR11695Panther ALCOHOL DEHYDROGENASE RELATED JGI ISS
PTHR11695:SF294Panther SUBFAMILY NOT NAMED JGI ISS
PF00107PFAM Zinc-binding dehydrogenase JGI ISS
UniRef100_G7LFT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alcohol dehydrogenase-like protein n=1 Tax=Medicago truncatula RepID=G7LFT7_MEDTR SoyBaseE_val: 9.00E-85ISS
UniRef100_UPI00018909F8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018909F8 related cluster n=1 Tax=unknown RepID=UPI00018909F8 SoyBaseE_val: 5.00E-89ISS

Expression Patterns of Glyma18g32630
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32630 not represented in the dataset
Glyma18g32630 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32630 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g32630
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g32630
>Glyma18g32630.1   sequence type=CDS   gene model=Glyma18g32630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGGCCTTCATCATGCCTTGTGGCAACTGCTCTTACTCTTCAAAGGGCCATGATGATCTATGTGAAGCTTTCTTTACCTATAACCGAGGAAAAGGAACCCTCTATGAAGGTGTAACTCGACTTTTTTTTTCCGAAATAGGGTATACACATGCTACTGATATTACTAATCCTAAACCACGCCAACTTCCTTTTTCATCAAAGAAATTTAATATGGGAGGGCTTGCTGAATACTGTGTTGTGCCAGCAAATAGAGTCTCTGTATTACCAAACTCATTGCCATATACAGAGTTTGCAATTCTAGGATGTGCTATTTTTACTGCTTACGGCGCCATGGCTCATGCACCTCAAGTGTGTCCTGGTGATTTTGTTGCTGTTATTGGAAGTGGAGGTGTTGGTTCTAGTTGTTTACAGATAGCTAAAGCCTTTGGTGCCTCAGATATAATTGTTATGGATGTACGGGATGAAAAGCTACAGAAAGCAAAGACATTTGGTGCTACTCACACTGTAAATTCAGCAAAGGAAGATCCCATTGAAAAGATA
Predicted protein sequences of Glyma18g32630
>Glyma18g32630.1   sequence type=predicted peptide   gene model=Glyma18g32630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAFIMPCGNCSYSSKGHDDLCEAFFTYNRGKGTLYEGVTRLFFSEIGYTHATDITNPKPRQLPFSSKKFNMGGLAEYCVVPANRVSVLPNSLPYTEFAILGCAIFTAYGAMAHAPQVCPGDFVAVIGSGGVGSSCLQIAKAFGASDIIVMDVRDEKLQKAKTFGATHTVNSAKEDPIEKI






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo