Glyma18g32591 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g32591): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g32591): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g32591

Feature Type:	gene_model
Chromosome:	Gm18
Start:	37859567
stop:	37859894
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g32591

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G57330	AT	Annotation by Michelle Graham. TAIR10: Galactose mutarotase-like superfamily protein \| chr5:23218392-23220664 FORWARD LENGTH=312	SoyBase	E_val: 4.00E-27	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0006012	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactose metabolic process	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004034	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aldose 1-epimerase activity	SoyBase	N/A	ISS
GO:0016853	GO-mf	Annotation by Michelle Graham. GO Molecular Function: isomerase activity	SoyBase	N/A	ISS
GO:0030246	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding	SoyBase	N/A	ISS
PTHR11122	Panther	APOSPORY-ASSOCIATED PROTEIN C-RELATED	JGI		ISS
PF01263	PFAM	Aldose 1-epimerase	JGI		ISS
UniRef100_I1MSN9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSN9_SOYBN	SoyBase	E_val: 3.00E-31	ISS
UniRef100_Q8S3Q3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Apospory-associated protein C n=1 Tax=Oryza sativa Japonica Group RepID=Q8S3Q3_ORYSJ	SoyBase	E_val: 8.00E-27	ISS

Expression Patterns of Glyma18g32591

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32591 not represented in the dataset	Glyma18g32591 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32591 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g157000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g32591

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g32591

Limit To All Plant Sequences

>Glyma18g32591.1   sequence type=CDS   gene model=Glyma18g32591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGAATCCTTGGGATAAGAAAGCAAAAGCTATGTCTGATTTCGGTGATGATGAGTATAAGTACATGCTTTGTGTAGAGGCTGCTGCTATTGAAAAGCCTATCTCTTTGAATCTTGTTGAGGGATGGAATGGAAGACTAGAACTTTCAACTGTTTCTTCTAGTTATTGTAGTGGAAAATTGATCCCAAAAGAGTTATTCAAGGAAGCTGAAAGATCATCGTTGTGTTTTGTGTCCTGTATATGTATTAAATGCACTTGA

Predicted protein sequences of Glyma18g32591

Limit To All Plant Sequences

>Glyma18g32591.1   sequence type=predicted peptide   gene model=Glyma18g32591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWNPWDKKAKAMSDFGDDEYKYMLCVEAAAIEKPISLNLVEGWNGRLELSTVSSSYCSGKLIPKELFKEAERSSLCFVSCICIKCT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain