SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g32513

Feature Type:gene_model
Chromosome:Gm18
Start:37765633
stop:37767416
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g32513
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G13110AT Annotation by Michelle Graham. TAIR10: serine acetyltransferase 2;2 | chr3:4214939-4216114 REVERSE LENGTH=391 SoyBaseE_val: 2.00E-31ISS
GO:0006535GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process from serine SoyBaseN/AISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0009001GO-mf Annotation by Michelle Graham. GO Molecular Function: serine O-acetyltransferase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
PTHR23416Panther SIALIC ACID SYNTHASE-RELATED JGI ISS
PTHR23416:SF18Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_Q5MYA1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine O-acetyltransferase 1 (Fragment) n=1 Tax=Glycine max RepID=Q5MYA1_SOYBN SoyBaseE_val: 3.00E-38ISS
UniRef100_UPI000233F248UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F248 related cluster n=1 Tax=unknown RepID=UPI000233F248 SoyBaseE_val: 4.00E-42ISS

Expression Patterns of Glyma18g32513
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32513 not represented in the dataset
Glyma18g32513 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32513 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g32513
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g32513
>Glyma18g32513.1   sequence type=CDS   gene model=Glyma18g32513   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCCAGGGACTTGTATTTTGGGGAACATTAAGATTGGTGATGGAGCTAAGATTGGTGCTTGTTCTGTTGTGTTGAAGGAAGTGCCACCAAGGACTACTGCTGTTGGGAACCCTGCTAGGGTGGTTGGAGGGAAGGATAACCCTATTAAATTGGATAAGGTGCCTAGTTTTACCATGGACCATACTTCATGGTCTGATTATGTTATATAG
Predicted protein sequences of Glyma18g32513
>Glyma18g32513.1   sequence type=predicted peptide   gene model=Glyma18g32513   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGPGTCILGNIKIGDGAKIGACSVVLKEVPPRTTAVGNPARVVGGKDNPIKLDKVPSFTMDHTSWSDYVI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo