Glyma18g32490 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g32490

Feature Type:	gene_model
Chromosome:	Gm18
Start:	37714165
stop:	37714711
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g32490

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G48430	AT	Annotation by Michelle Graham. TAIR10: Dihydroxyacetone kinase \| chr1:17902874-17906689 REVERSE LENGTH=593	SoyBase	E_val: 2.00E-15	ISS
GO:0006071	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycerol metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004371	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glycerone kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PTHR10854	Panther	DIHYDROXYACETONE KINASE-RELATED	JGI		ISS
PF02733	PFAM	Dak1 domain	JGI		ISS
UniRef100_C0Z2K3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT1G48430 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2K3_ARATH	SoyBase	E_val: 7.00E-14	ISS
UniRef100_I1KJA0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJA0_SOYBN	SoyBase	E_val: 3.00E-14	ISS

Expression Patterns of Glyma18g32490

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32490 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g156700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g32490

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g32490

Limit To All Plant Sequences

>Glyma18g32490.1   sequence type=CDS   gene model=Glyma18g32490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACTAATGATTGTAGCTAGAAAAATAGTTCCAAAATTACAACTGGAACATGGATTGTCTGTTGATAGAGTTTATACAGGGTCATTTATGACTTCTCTTGATATGGCAGGTTTGTTGCCACAACTATTAGCAATCAGCCTTTTTCTTTTGTGA

Predicted protein sequences of Glyma18g32490

Limit To All Plant Sequences

>Glyma18g32490.1   sequence type=predicted peptide   gene model=Glyma18g32490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELMIVARKIVPKLQLEHGLSVDRVYTGSFMTSLDMAGLLPQLLAISLFLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain