SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g32490

Feature Type:gene_model
Chromosome:Gm18
Start:37714165
stop:37714711
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48430AT Annotation by Michelle Graham. TAIR10: Dihydroxyacetone kinase | chr1:17902874-17906689 REVERSE LENGTH=593 SoyBaseE_val: 2.00E-15ISS
GO:0006071GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004371GO-mf Annotation by Michelle Graham. GO Molecular Function: glycerone kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR10854Panther DIHYDROXYACETONE KINASE-RELATED JGI ISS
PF02733PFAM Dak1 domain JGI ISS
UniRef100_C0Z2K3UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT1G48430 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2K3_ARATH SoyBaseE_val: 7.00E-14ISS
UniRef100_I1KJA0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJA0_SOYBN SoyBaseE_val: 3.00E-14ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g156700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g32490.1   sequence type=CDS   gene model=Glyma18g32490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACTAATGATTGTAGCTAGAAAAATAGTTCCAAAATTACAACTGGAACATGGATTGTCTGTTGATAGAGTTTATACAGGGTCATTTATGACTTCTCTTGATATGGCAGGTTTGTTGCCACAACTATTAGCAATCAGCCTTTTTCTTTTGTGA

>Glyma18g32490.1   sequence type=predicted peptide   gene model=Glyma18g32490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELMIVARKIVPKLQLEHGLSVDRVYTGSFMTSLDMAGLLPQLLAISLFLL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo