SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g32231

Feature Type:gene_model
Chromosome:Gm18
Start:37324052
stop:37324569
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g32231
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG01090AT Annotation by Michelle Graham. TAIR10: NADPH dehydrogenases | chrC:119244-119762 REVERSE LENGTH=172 SoyBaseE_val: 4.00E-51ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003959GO-mf Annotation by Michelle Graham. GO Molecular Function: NADPH dehydrogenase activity SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016651GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
GO:0051539GO-mf Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding SoyBaseN/AISS
PTHR10849Panther NADH-UBIQUINONE OXIDOREDUCTASE 1, CHAIN 1 JGI ISS
UniRef100_Q2PMN6UniRef Annotation by Michelle Graham. Best UniRef hit: NAD(P)H-quinone oxidoreductase subunit I, chloroplastic n=1 Tax=Glycine max RepID=NDHI_SOYBN SoyBaseE_val: 3.00E-54ISS
UniRef100_Q2PMN6UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit I, chloroplastic n=1 Tax=Glycine max RepID=NDHI_SOYBN SoyBaseE_val: 3.00E-54ISS

Expression Patterns of Glyma18g32231
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g32231 not represented in the dataset
Glyma18g32231 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g32231 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g155500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g32231
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g32231
>Glyma18g32231.1   sequence type=CDS   gene model=Glyma18g32231   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCCTTATGGTAAGTGGATCCATAAATTATAGTCAACAAACAGTCCGAGTTGCAAGGTACACTGGTCAGGGTTTCACGATTACTCTATCTCACACAAATCGGTTACCCGTAACTATTCAATATCCTTATGAAAAAATAATCTCATCAGAATGTTTCCGTGGTCAAATACATTTTGAATTTGATAAATGCATTGCTTGTGAAGTATGTGTTCGTGTATGTCCCATCGATCTACCCATTGTTGATTGGAAACTAGAAACTGATATTCAAAATAAATAA
Predicted protein sequences of Glyma18g32231
>Glyma18g32231.1   sequence type=predicted peptide   gene model=Glyma18g32231   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLMVSGSINYSQQTVRVARYTGQGFTITLSHTNRLPVTIQYPYEKIISSECFRGQIHFEFDKCIACEVCVRVCPIDLPIVDWKLETDIQNK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo