|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG01130 | AT | Annotation by Michelle Graham. TAIR10: Ycf1 protein | chrC:123884-129244 REVERSE LENGTH=1786 | SoyBase | E_val: 8.00E-30 | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| UniRef100_G9IJ28 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ycf1 n=1 Tax=Millettia pinnata RepID=G9IJ28_9FABA | SoyBase | E_val: 3.00E-64 | ISS |
| UniRef100_UPI000233EC9F | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233EC9F related cluster n=1 Tax=unknown RepID=UPI000233EC9F | SoyBase | E_val: 6.00E-152 | ISS |
|
Glyma18g32201 not represented in the dataset |
Glyma18g32201 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.18g155800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g32201.1 sequence type=CDS gene model=Glyma18g32201 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAAAAAAATCTGGATAGAAAGTATTTTGATTGGATGGGAATCAATAGAGAAATACTAAATCATTCCATATCAAATCCAGAATTTTGGTTCTTTTCAAAATTTGTGATATTTTATGACGCATATAAGGGTAACTCACAGCAGGTTATACCAATCAAATTACTTTTTTTTTCTTATAATGTAAATCAAAATGTTAGTCAAAATAAAACGAACATTACTAGAAAGAAAAAAAATGAATCTCTTGAATTGGAGTTAGAGACTCGAAATCGGGCAAAAGTAGAATACCCTGATCAACGAAATCTTGAATTATCTATCTCAAACCAAGAGAAAGATATTGAAAACAATTATGTAGTATCAGACAGTGAAAAGAATAGTAAGGGTATAAAGAAAAAGAAAGACAAGAACAAGATGGAGGCAGAACTAAATTTCTTACTACGAAATTTTTTGATTTTACATTTGAATTGGAATAATTTCTTAGGTCAAAGAATATTTAACAATGTCAAAATATATTGTCTCCTGATTAGATTAAAAAATTTAAGAGAAATTACAATAGCCTCTATTCAAAGAGGAGAACTAGGTCTAGATATTATGATGATTCAAAATCAGAAGAATTTAATTCTTCTAGGCTTAAGGAAAAAGAAAATAACAAATTTATGA
>Glyma18g32201.1 sequence type=predicted peptide gene model=Glyma18g32201 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEKNLDRKYFDWMGINREILNHSISNPEFWFFSKFVIFYDAYKGNSQQVIPIKLLFFSYNVNQNVSQNKTNITRKKKNESLELELETRNRAKVEYPDQRNLELSISNQEKDIENNYVVSDSEKNSKGIKKKKDKNKMEAELNFLLRNFLILHLNWNNFLGQRIFNNVKIYCLLIRLKNLREITIASIQRGELGLDIMMIQNQKNLILLGLRKKKITNL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||