SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g30280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g30280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g30280

Feature Type:gene_model
Chromosome:Gm18
Start:35004289
stop:35004715
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g30280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G67030AT Annotation by Michelle Graham. TAIR10: zeaxanthin epoxidase (ZEP) (ABA1) | chr5:26754026-26757090 REVERSE LENGTH=610 SoyBaseE_val: 5.00E-30ISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009688GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0016123GO-bp Annotation by Michelle Graham. GO Biological Process: xanthophyll biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0009540GO-mf Annotation by Michelle Graham. GO Molecular Function: zeaxanthin epoxidase [overall] activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR13789Panther MONOOXYGENASE JGI ISS
PTHR13789:SF10Panther SALICYLATE HYDROXYLASE JGI ISS
UniRef100_G7JVQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zeaxanthin epoxidase n=1 Tax=Medicago truncatula RepID=G7JVQ7_MEDTR SoyBaseE_val: 4.00E-46ISS
UniRef100_I1KZP6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZP6_SOYBN SoyBaseE_val: 3.00E-53ISS

Expression Patterns of Glyma18g30280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g30280 not represented in the dataset
Glyma18g30280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g30280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g30280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g30280
>Glyma18g30280.1   sequence type=CDS   gene model=Glyma18g30280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGCATTCAAAACTCTTTGGGCGGCAAGAAGCAAATTACTCGAGTTTCACATGCTACAGGGGATTAACAAGATATGTGCCCCCATATATTGATACCGTTGGGTATCGGGTGTTCTTGGGCTTGAACCAGTACTTTGTTGCTTCAGATGTTGGCCATGGCAAGATGCAGTGGTATGCTTTCCATGGGGAACCCCCTTCAAGTGACCCTTTCCCAGAAGTAGGTAAGAAGAAGAGGCTTTTGGATCTCTTTGGTAATTGGTGCGATGAA
Predicted protein sequences of Glyma18g30280
>Glyma18g30280.1   sequence type=predicted peptide   gene model=Glyma18g30280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VHSKLFGRQEANYSSFTCYRGLTRYVPPYIDTVGYRVFLGLNQYFVASDVGHGKMQWYAFHGEPPSSDPFPEVGKKKRLLDLFGNWCDE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo