Glyma18g29860 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g29860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g29860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g29860

Feature Type:	gene_model
Chromosome:	Gm18
Start:	34329598
stop:	34329880
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g29860

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G28570	AT	Annotation by Michelle Graham. TAIR10: Long-chain fatty alcohol dehydrogenase family protein \| chr4:14119548-14121923 FORWARD LENGTH=748	SoyBase	E_val: 2.00E-27	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016614	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on CH-OH group of donors	SoyBase	N/A	ISS
GO:0046577	GO-mf	Annotation by Michelle Graham. GO Molecular Function: long-chain-alcohol oxidase activity	SoyBase	N/A	ISS
GO:0050660	GO-mf	Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding	SoyBase	N/A	ISS
PTHR10668	Panther	PHYTOENE DEHYDROGENASE	JGI		ISS
PTHR10668:SF14	Panther	PHYTOENE DEHYDROGENASE	JGI		ISS
PF05199	PFAM	GMC oxidoreductase	JGI		ISS
UniRef100_I1N9S7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N9S7_SOYBN	SoyBase	E_val: 1.00E-30	ISS
UniRef100_Q94BP3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Long-chain-alcohol oxidase FAO4B n=1 Tax=Arabidopsis thaliana RepID=FAO4B_ARATH	SoyBase	E_val: 1.00E-24	ISS

Expression Patterns of Glyma18g29860

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g29860 not represented in the dataset	Glyma18g29860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g29860 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g145900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g29860

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g29860

Limit To All Plant Sequences

>Glyma18g29860.1   sequence type=CDS   gene model=Glyma18g29860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCCTCTGAAGAAGAAGGTGCACTCGATGAGAATGGTGAGACTTGGGAAGCAGAAGGCTTGTATGTGTGTGATGGGAATGTTTTGCCTAGTGCAGTTGGTGTCAACCCCATGGTAACCATTCAGTCTACATCTTACTGTATTGCTAGTAAGATTGTTGAATCACTTGGCAAAGCATCAATCAAAATTGACATGCATGCATTTAATACCAACTTACCAATCAATCAAAAAAAACTAAGATACACCAAGTTACCAACCAATAACAACCCATAA

Predicted protein sequences of Glyma18g29860

Limit To All Plant Sequences

>Glyma18g29860.1   sequence type=predicted peptide   gene model=Glyma18g29860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGASEEEGALDENGETWEAEGLYVCDGNVLPSAVGVNPMVTIQSTSYCIASKIVESLGKASIKIDMHAFNTNLPINQKKLRYTKLPTNNNP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain