SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g29546

Feature Type:gene_model
Chromosome:Gm18
Start:34177119
stop:34178999
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g29546
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10470AT Annotation by Michelle Graham. TAIR10: kinesin like protein for actin based chloroplast movement 1 | chr5:3290121-3297248 REVERSE LENGTH=1273 SoyBaseE_val: 3.00E-35ISS
GO:0000910GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis SoyBaseN/AISS
GO:0000913GO-bp Annotation by Michelle Graham. GO Biological Process: preprophase band assembly SoyBaseN/AISS
GO:0007018GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based movement SoyBaseN/AISS
GO:0009903GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast avoidance movement SoyBaseN/AISS
GO:0009904GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast accumulation movement SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009504GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell plate SoyBaseN/AISS
GO:0009524GO-cc Annotation by Michelle Graham. GO Cellular Compartment: phragmoplast SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003777GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule motor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008017GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule binding SoyBaseN/AISS
UniRef100_Q9LX99UniRef Annotation by Michelle Graham. Most informative UniRef hit: Geminivirus Rep-interacting motor protein n=1 Tax=Arabidopsis thaliana RepID=GRIMP_ARATH SoyBaseE_val: 2.00E-32ISS
UniRef100_UPI000233EC98UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EC98 related cluster n=1 Tax=unknown RepID=UPI000233EC98 SoyBaseE_val: 3.00E-70ISS

Expression Patterns of Glyma18g29546
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g29546 not represented in the dataset
Glyma18g29546 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g29546 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g146700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g29546
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g29546
>Glyma18g29546.1   sequence type=CDS   gene model=Glyma18g29546   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAGCAAAAGAACCGGTGGAGCTGGGACGTCGCCGGCTTTGACCCGTGGAAGTCGTCTACGCCTCCGCAGTCGCCGGCGGCGGCGGAACACGGCGATCGGAAACCTAGTGCGCCGTTGGTGCGGCGGTACTCCATTTCGGCCACGTCGGTTCTTCCGCAATCGAAGCACGCTGTGGCCTTCAAGCTTCAGCGGCTGAAGGACCAAGTCAAGCTTGCTAAAGAAGACTATTTGCAATTAAGACAAGAAGCAAGTGAACTTCAAGAATATTCAAATGCAAAACTTGATCGAGTTACACGATATCTAGGTGTTCTTGCAGAGAAAACCCGCAATCTAGGTAAGAAACTAATTTATCTTGACTCATGGATCATGCTTAAATGA
Predicted protein sequences of Glyma18g29546
>Glyma18g29546.1   sequence type=predicted peptide   gene model=Glyma18g29546   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEQKNRWSWDVAGFDPWKSSTPPQSPAAAEHGDRKPSAPLVRRYSISATSVLPQSKHAVAFKLQRLKDQVKLAKEDYLQLRQEASELQEYSNAKLDRVTRYLGVLAEKTRNLGKKLIYLDSWIMLK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo