SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g26190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g26190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g26190

Feature Type:gene_model
Chromosome:Gm18
Start:30311782
stop:30314590
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10360AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S6e | chr5:3258734-3260142 REVERSE LENGTH=249 SoyBaseE_val: 3.00E-163ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0042274GO-bp Annotation by Michelle Graham. GO Biological Process: ribosomal small subunit biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1646 KOG 40S ribosomal protein S6 JGI ISS
PTHR11502Panther 40S RIBOSOMAL PROTEIN S6 JGI ISS
PF01092PFAM Ribosomal protein S6e JGI ISS
UniRef100_B2BF98UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S6 n=2 Tax=Glycine max RepID=B2BF98_SOYBN SoyBaseE_val: 5.00E-177ISS
UniRef100_B2BF98UniRef Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S6 n=2 Tax=Glycine max RepID=B2BF98_SOYBN SoyBaseE_val: 5.00E-177ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g26190 not represented in the dataset

Glyma18g26190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g45770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g151800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g26190.1   sequence type=CDS   gene model=Glyma18g26190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTTCAACATCGCGAGTCCCACCACTGGATGCCAGAAGAAGCTCGAGATCGACGACGATCAGAAACTACGAGCATTTTGGGACAAGAGGATCTCACAGGAGGTCAGCGGAGATGCACTTGGTGAGGAATTTAAGGGCTATGTCTTCAAAATTACTGGAGGTTGTGACAAACAAGGATTCCCGATGAAACAGGGAGTGCTTACTCCTGGTCGTGTTCGACTTTTGCTTCACAGGGGAACTCCTTGCTTCCGTGGATATGGAAGGCGTAATGGAGAACGTAGGAGAAAGTCTGTTCGTGGGTGCATTGTCAGCCCAGACCTCTCTGTTTTGAACTTGGTAATTGTGAAGAAGGGTGAGAATGATTTACCAGGATTGACTGATGCTGAGAAGCCAAGGATGAGAGGCCCAAAGAGAGCATCCAAAATCCGTAAACTGTTCAACCTGTCCAAGGAGGATGATGTTAGGAAGTATGTCAACACCTACCGTCGTACATTTACGACAAAAGCTGGGAAAAAGGTGAGCAAAGCTCCTAAGATACAAAGACTGGTCACCCCTCTTACGCTCCAACGAAAGCGGGCAAGAATTGCTGATAAAAAGAAGAGAATTGCCAAGGCCAAATCGGAGGCAGCAGAGTACCAGAAACTCCTTGCCTCCAGGTTGAAGGAGCAGAGAGACCGCCGCAGTGAGAGTTTGGCTAAGAGGAGATCCAAGCTTTCCAGTGCTGCCAAGGCAGCTGTGTAA

>Glyma18g26190.1   sequence type=predicted peptide   gene model=Glyma18g26190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKFNIASPTTGCQKKLEIDDDQKLRAFWDKRISQEVSGDALGEEFKGYVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDAEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPKIQRLVTPLTLQRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSAAKAAV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo