SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g26151

Feature Type:gene_model
Chromosome:Gm18
Start:30111907
stop:30114663
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g26151
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48460AT Annotation by Michelle Graham. TAIR10: Actin binding Calponin homology (CH) domain-containing protein | chr5:19636225-19639365 REVERSE LENGTH=654 SoyBaseE_val: 4.00E-28ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0030048GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament-based movement SoyBaseN/AISS
GO:0051645GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi localization SoyBaseN/AISS
GO:0051646GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrion localization SoyBaseN/AISS
GO:0060151GO-bp Annotation by Michelle Graham. GO Biological Process: peroxisome localization SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003779GO-mf Annotation by Michelle Graham. GO Molecular Function: actin binding SoyBaseN/AISS
PTHR19961Panther FIMBRIN/PLASTIN JGI ISS
PTHR19961:SF9Panther FIMBRIN-RELATED JGI ISS
PF00307PFAM Calponin homology (CH) domain JGI ISS
UniRef100_G7LEC3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Fimbrin n=1 Tax=Medicago truncatula RepID=G7LEC3_MEDTR SoyBaseE_val: 7.00E-36ISS
UniRef100_I1KYY8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYY8_SOYBN SoyBaseE_val: 1.00E-48ISS

Expression Patterns of Glyma18g26151
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g26151 not represented in the dataset
Glyma18g26151 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g26151
ParalogEvidenceComments
Glyma08g45800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g26151 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g152200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g26151
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g26151
>Glyma18g26151.1   sequence type=CDS   gene model=Glyma18g26151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAATGCAACCTACATTATCAGTATTGCAAGAAAGCTTGGATGTTCAATATTCTTGCTTCCCGAAGACATCACTGAGGTGAATCAAAACATGATCCTTACACTAACAGCTAGTATAATGTATTGGTTCTTAAAGCACCCTCTCGAGGAAAGAACAGTAGGAAATTCAGACAGTGAGAGTGGGAGTCAATTGGAAACTACATCAAATTCAACACTGGATGACTCTGCTTCTGATTCATCGGCAGAGGAGAAGGGGAGCATGTAA
Predicted protein sequences of Glyma18g26151
>Glyma18g26151.1   sequence type=predicted peptide   gene model=Glyma18g26151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMNATYIISIARKLGCSIFLLPEDITEVNQNMILTLTASIMYWFLKHPLEERTVGNSDSESGSQLETTSNSTLDDSASDSSAEEKGSM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo