SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g26140

Feature Type:gene_model
Chromosome:Gm18
Start:30073575
stop:30076554
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48500AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G10930.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:19653235-19654017 FORWARD LENGTH=167 SoyBaseE_val: 8.00E-32ISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N1R7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N1R7_SOYBN SoyBaseE_val: 3.00E-105ISS
UniRef100_Q9LV64UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD28645.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LV64_ARATH SoyBaseE_val: 3.00E-26ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g45830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g152300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g26140.1   sequence type=CDS   gene model=Glyma18g26140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAATGCCACTACAAGAAGAGCCAGGTGCCAGCTTTTGGGAGTTGGGATTGGAACGATAACCTACATTTCACACAGTGCTTCGAGTCAGCGAGGCAAGCTGGTTTGCTACGATGTAGTTACTCTGAGTCTGAGGAACGTGACCTTTATGTTACAGGGGATTTGTACGAGAATAATGTTGTCACACCCGCCATGATCGTTGTTCCTCGCAGAAGGGCAAAGGTGGTTGACCAGCATGAAAAAGAAACAAAATTGAAGAATTGGATCAGTGATGATGTGGATAGTGAACCACCCAGCCCAACTCCACTGCCAAGGCCGACTTCAAAACCCGTTGATGAGGACTTGTACAAGATCTCACCGGGGCTTCTTTATGCCAAAGCTAAAAAGAAGAGAGGGTTGTGCTTCTTTTCTAGTTGCTTGTTACCAACTTGCGTTGCTTGA

>Glyma18g26140.1   sequence type=predicted peptide   gene model=Glyma18g26140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEECHYKKSQVPAFGSWDWNDNLHFTQCFESARQAGLLRCSYSESEERDLYVTGDLYENNVVTPAMIVVPRRRAKVVDQHEKETKLKNWISDDVDSEPPSPTPLPRPTSKPVDEDLYKISPGLLYAKAKKKRGLCFFSSCLLPTCVA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo