SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g26120

Feature Type:gene_model
Chromosome:Gm18
Start:30001494
stop:30003858
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48490AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr5:19647932-19648237 REVERSE LENGTH=101 SoyBaseE_val: 4.00E-21ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_C6T3R1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3R1_SOYBN SoyBaseE_val: 3.00E-65ISS
UniRef100_F5BR62UniRef Annotation by Michelle Graham. Most informative UniRef hit: Defective in induced resistance 1 protein n=1 Tax=Nicotiana tabacum RepID=F5BR62_TOBAC SoyBaseE_val: 1.00E-30ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g152400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g26120.1   sequence type=CDS   gene model=Glyma18g26120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACAAAAGAAGTTTGTGGCACTATTAATGGTGGTGGTGGTGATGGCTTCTTCTATGTGGAAAGGATCCAAAGGTCTTAGTCTCTGTAACATGGATGAAGATGGATTGGAGGCTTGCAAGCCCTCAGTGACTCAGCCAAACCCAGTTGATCCATCCCCTGATTGCTGCAAGGCTCTGGATGGTGCTGACTTGAAGTGCCTTTGCTCTTACAAGAACTCATCAGAGTTGCCTCTTCTAGGAATTGATCTAACTCTTGCTGCTTCACTTCCTGCAAAGTGCAATCTCACTCCTCCAGATAATTGCTAA

>Glyma18g26120.1   sequence type=predicted peptide   gene model=Glyma18g26120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQKKFVALLMVVVVMASSMWKGSKGLSLCNMDEDGLEACKPSVTQPNPVDPSPDCCKALDGADLKCLCSYKNSSELPLLGIDLTLAASLPAKCNLTPPDNC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo