Glyma18g26120 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g26120

Feature Type:	gene_model
Chromosome:	Gm18
Start:	30001494
stop:	30003858
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g26120

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G48490	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr5:19647932-19648237 REVERSE LENGTH=101	SoyBase	E_val: 4.00E-21	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_C6T3R1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3R1_SOYBN	SoyBase	E_val: 3.00E-65	ISS
UniRef100_F5BR62	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Defective in induced resistance 1 protein n=1 Tax=Nicotiana tabacum RepID=F5BR62_TOBAC	SoyBase	E_val: 1.00E-30	ISS

Expression Patterns of Glyma18g26120

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g26120 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g152400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g26120

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g26120

Limit To All Plant Sequences

>Glyma18g26120.1   sequence type=CDS   gene model=Glyma18g26120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACAAAAGAAGTTTGTGGCACTATTAATGGTGGTGGTGGTGATGGCTTCTTCTATGTGGAAAGGATCCAAAGGTCTTAGTCTCTGTAACATGGATGAAGATGGATTGGAGGCTTGCAAGCCCTCAGTGACTCAGCCAAACCCAGTTGATCCATCCCCTGATTGCTGCAAGGCTCTGGATGGTGCTGACTTGAAGTGCCTTTGCTCTTACAAGAACTCATCAGAGTTGCCTCTTCTAGGAATTGATCTAACTCTTGCTGCTTCACTTCCTGCAAAGTGCAATCTCACTCCTCCAGATAATTGCTAA

Predicted protein sequences of Glyma18g26120

Limit To All Plant Sequences

>Glyma18g26120.1   sequence type=predicted peptide   gene model=Glyma18g26120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQKKFVALLMVVVVMASSMWKGSKGLSLCNMDEDGLEACKPSVTQPNPVDPSPDCCKALDGADLKCLCSYKNSSELPLLGIDLTLAASLPAKCNLTPPDNC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain