|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G52590 | AT | Annotation by Michelle Graham. TAIR10: ubiquitin extension protein 1 | chr3:19505668-19506681 FORWARD LENGTH=128 | SoyBase | E_val: 5.00E-47 | ISS |
GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
KOG0003 | KOG | Ubiquitin/60s ribosomal protein L40 fusion | JGI | ISS | |
PTHR10666 | Panther | UBIQUITIN | JGI | ISS | |
PF00240 | PFAM | Ubiquitin family | JGI | ISS | |
UniRef100_I1N1R4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N1R4_SOYBN | SoyBase | E_val: 3.00E-60 | ISS |
UniRef100_Q9AYQ8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin (Fragment) n=1 Tax=Eustoma exaltatum subsp. russellianum RepID=Q9AYQ8_EUSER | SoyBase | E_val: 1.00E-45 | ISS |
Glyma18g25870 not represented in the dataset |
Glyma18g25870 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.18g152700 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g25870.2 sequence type=CDS gene model=Glyma18g25870 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAGATCTTCGTGAAAACCCTAACAGGGAAGACTATAACCTTCAAGGTCGAAAGCAGGGACACCATCGACAATGTCAAGGGCAAGATTCAAGACAAGGAAGATCAGCAGTGCTTAATTTTTGTCGAAAAGCAACTTGAAGATGGAAGGACCTTGGCCGATTACAACATCAAGAAGGAATCAACCTTTCACCTTCTCCTCAAGCTTCGTGGTGGCATCATCAAGCCTTCCTTTATGGCATTGGCTCGCAAATACAACCTAGACAAGATGATTTTCCATAAGTATGCAGTCTATCTTTTTTTGTTTCGTTTTTTATTGAGTTTTATGGGACGATAA
>Glyma18g25870.2 sequence type=predicted peptide gene model=Glyma18g25870 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQIFVKTLTGKTITFKVESRDTIDNVKGKIQDKEDQQCLIFVEKQLEDGRTLADYNIKKESTFHLLLKLRGGIIKPSFMALARKYNLDKMIFHKYAVYLFLFRFLLSFMGR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||