|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G09640 | AT | Annotation by Michelle Graham. TAIR10: ascorbate peroxidase 2 | chr3:2956301-2958163 FORWARD LENGTH=251 | SoyBase | E_val: 7.00E-20 | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0004601 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: peroxidase activity | SoyBase | N/A | ISS |
| GO:0016688 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: L-ascorbate peroxidase activity | SoyBase | N/A | ISS |
| GO:0020037 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme binding | SoyBase | N/A | ISS |
| PF00141 | PFAM | Peroxidase | JGI | ISS | |
| UniRef100_I1K1Y4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1Y4_SOYBN | SoyBase | E_val: 9.00E-32 | ISS |
| UniRef100_Q43758 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ascorbate peroxidase n=1 Tax=Glycine max RepID=Q43758_SOYBN | SoyBase | E_val: 5.00E-21 | ISS |
|
Glyma18g25810 not represented in the dataset |
Glyma18g25810 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g25810.1 sequence type=CDS gene model=Glyma18g25810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ACTCTGCTGGAACCTTTGACAAGGGCACAAACACTAGTGGACCCTTCGGACATCGCTATTAGGCTTTTGGAGCCACTCAAGGTGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACCCGTTGGCTGGCGTTGTTGCCGTTGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTGAAAGAGAG
>Glyma18g25810.1 sequence type=predicted peptide gene model=Glyma18g25810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TLLEPLTRAQTLVDPSDIAIRLLEPLKVEFPILSYADFYPLAGVVAVEVTGGPEVPFHPERE
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||