SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g25785

Feature Type:gene_model
Chromosome:Gm18
Start:29583045
stop:29598519
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g25785
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G24820AT Annotation by Michelle Graham. TAIR10: BSD domain-containing protein | chr3:9062717-9064366 REVERSE LENGTH=186 SoyBaseE_val: 6.00E-48ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03909PFAM BSD domain JGI ISS
UniRef100_C6TJV1UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=2 Tax=Glycine max RepID=C6TJV1_SOYBN SoyBaseE_val: 1.00E-128ISS
UniRef100_D7L5T3UniRef Annotation by Michelle Graham. Most informative UniRef hit: BSD domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L5T3_ARALL SoyBaseE_val: 2.00E-43ISS

Expression Patterns of Glyma18g25785
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g25785 not represented in the dataset
Glyma18g25785 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g25785 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g153000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g25785
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g25785
>Glyma18g25785.1   sequence type=CDS   gene model=Glyma18g25785   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGGCTTAGACGCGGCCTATCTAGGGGTTCAAGGAATAGCAAAACCCCAAATATCCAAACGCAGTCCAACTCCGAAGTACAGCAACACCTAGAAGAAAGCATATACGGGATTACCGAGGAACTCATCAACCACATCAAGACCTTCACCCTTGACACCTTTAAGAATTTCCCTCTCCAAGATGAAGTTGAAGGCAGTTATGGGGAAGACACTCAATCCTCTTCAACCAAAGTTCGAAATGAACTTTCTCAGTGGCAAGAGAAACATGCAATCCTCGTACTCTCAAGAGTCAAGGAAATGTCTCAACTGAGATATGTACTGTGTCCTCGCCATTTGAAGGAAAGTCAATTCTGGAAAATTTACTTTAAGCTTGCTAGGAGCCATGTTCTTGAATATGAGCTTCGTGACATACAACGGGAGAAACTGAAACAGATGGCAGTGGAAGATGAGAAATCTTCAGATAACAATCCGTATGAAGTTGAAATGGCAGAAGCAAATCATGAAAACTTTATTGAGCCTCTACCGCCCTCATAG
Predicted protein sequences of Glyma18g25785
>Glyma18g25785.1   sequence type=predicted peptide   gene model=Glyma18g25785   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDWLRRGLSRGSRNSKTPNIQTQSNSEVQQHLEESIYGITEELINHIKTFTLDTFKNFPLQDEVEGSYGEDTQSSSTKVRNELSQWQEKHAILVLSRVKEMSQLRYVLCPRHLKESQFWKIYFKLARSHVLEYELRDIQREKLKQMAVEDEKSSDNNPYEVEMAEANHENFIEPLPPS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo