SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g24230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g24230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g24230

Feature Type:gene_model
Chromosome:Gm18
Start:27864216
stop:27865265
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g24230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23890AT Annotation by Michelle Graham. TAIR10: topoisomerase II | chr3:8624931-8631106 FORWARD LENGTH=1473 SoyBaseE_val: 2.00E-78ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000712GO-bp Annotation by Michelle Graham. GO Biological Process: resolution of meiotic recombination intermediates SoyBaseN/AISS
GO:0000819GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid segregation SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006200GO-bp Annotation by Michelle Graham. GO Biological Process: ATP catabolic process SoyBaseN/AISS
GO:0006259GO-bp Annotation by Michelle Graham. GO Biological Process: DNA metabolic process SoyBaseN/AISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006265GO-bp Annotation by Michelle Graham. GO Biological Process: DNA topological change SoyBaseN/AISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006312GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic recombination SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0007059GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome segregation SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009957GO-bp Annotation by Michelle Graham. GO Biological Process: epidermal cell fate specification SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0016458GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051329GO-bp Annotation by Michelle Graham. GO Biological Process: interphase of mitotic cell cycle SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0000795GO-cc Annotation by Michelle Graham. GO Cellular Compartment: synaptonemal complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005694GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chromosome SoyBaseN/AISS
GO:0009330GO-cc Annotation by Michelle Graham. GO Cellular Compartment: DNA topoisomerase complex (ATP-hydrolyzing) SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003916GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA topoisomerase activity SoyBaseN/AISS
GO:0003918GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA topoisomerase type II (ATP-hydrolyzing) activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008094GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-dependent ATPase activity SoyBaseN/AISS
PTHR10169Panther DNA TOPOISOMERASE/GYRASE JGI ISS
PTHR10169:SF19Panther DNA TOPOISOMERASE 2 JGI ISS
PF00521PFAM DNA gyrase/topoisomerase IV, subunit A JGI ISS
UniRef100_I1MJQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA topoisomerase 2 n=1 Tax=Glycine max RepID=I1MJQ7_SOYBN SoyBaseE_val: 4.00E-126ISS
UniRef100_I1MJQ7UniRef Annotation by Michelle Graham. Best UniRef hit: DNA topoisomerase 2 n=1 Tax=Glycine max RepID=I1MJQ7_SOYBN SoyBaseE_val: 4.00E-126ISS

Expression Patterns of Glyma18g24230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g24230 not represented in the dataset
Glyma18g24230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g24230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g24230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g24230
>Glyma18g24230.1   sequence type=CDS   gene model=Glyma18g24230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCCGGCCTCACCGGTACATACCAGTCATACCGTTGGTTCTTGTCAATGGTAGTCAACGAATTGGGACAGGCTGCAGTTCTTACATTCCCAATTATAATCCAAGGGACATCATTGCCAATGTTAGGCGTTTGTTGAGTAGGGAGACAATGGTGCCAATGGATCCATGGTACAAAGGATTCAAAGGAACCATTGAGACAAGCCCCAAGGAAGGTGGATACGTAGTCAATGGCTCAGTGGAGGAAATAAATGAACACAATTTCAGAATCACTGAGCTGCCTATTCGCAAATGGACCCAAGATTACAAGCAGTTCCTTGACTCTATAACTGATGGGTCACCTAATGATTTCAGGCAGAATGGTGATGATGCAACCGTAAACATAGAAGTCAGGATGAAGCTTGAAAAAATAGTGGGCATCATGCAAGAGGGTCTACTTAAGAAGTTTAAACTCACATCCTCTATTAGCACAAACAACATGCATCTATTTGACACAGAAGGGAAAATTAAGAAATATGAGAATCCAGAACAAATTCTTGAAGAGTTCTTCCTCCTCCGGCTGAAGTATTATGAGAGAAGGAAGAAGAAAGCTGATTTGATGATTGAGTTGCAGCAGAAAGGTTTCACTCCCATGCCTAGGAAAGGTAAATCTGCAGAACCCTAA
Predicted protein sequences of Glyma18g24230
>Glyma18g24230.1   sequence type=predicted peptide   gene model=Glyma18g24230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VRPHRYIPVIPLVLVNGSQRIGTGCSSYIPNYNPRDIIANVRRLLSRETMVPMDPWYKGFKGTIETSPKEGGYVVNGSVEEINEHNFRITELPIRKWTQDYKQFLDSITDGSPNDFRQNGDDATVNIEVRMKLEKIVGIMQEGLLKKFKLTSSISTNNMHLFDTEGKIKKYENPEQILEEFFLLRLKYYERRKKKADLMIELQQKGFTPMPRKGKSAEP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo