SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g23340

Feature Type:gene_model
Chromosome:Gm18
Start:26982652
stop:26984276
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g23340
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56730AT Annotation by Michelle Graham. TAIR10: Insulinase (Peptidase family M16) protein | chr5:22946906-22952576 REVERSE LENGTH=956 SoyBaseE_val: 4.00E-13ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004222GO-mf Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
UniRef100_B9RKC8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial-processing peptidase subunit beta, mitochondrial, putative n=1 Tax=Ricinus communis RepID=B9RKC8_RICCO SoyBaseE_val: 1.00E-11ISS
UniRef100_UPI000233EE02UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EE02 related cluster n=1 Tax=unknown RepID=UPI000233EE02 SoyBaseE_val: 4.00E-41ISS

Expression Patterns of Glyma18g23340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g23340 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g23340
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g23340
>Glyma18g23340.1   sequence type=CDS   gene model=Glyma18g23340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAACTCTTATTTCTTCTGGAAAAAGTGACTTACAAAAGGTTGATCCATGGAAAGCTTGTGAATTCTTCAGCACATGTTTCAAAGATCCATCAACATTTCCTGTTGTGATTGTTGGGAACATTGATCCCATTATTCAATCCTTTGTCCTCCTCAGTCCTCTCCCCCATAAGACTTTTTTTCTACTTCTCACATTAGAATCAACTTCAATTAATCTAGATGTAGTAGATATCTGGAGTTATTTTGGGAAGTTCAACTGTTCTCAACTTTCCAATATATCTCTCATTTCATGCTATGCTATACAGGTTGAGGGTGCAGCAATGTCTGGCATTTCACCAAGTCCATATCAAAAGTTCTTGAAGTCTGTTAGGCCTCCTTCAATTCCATCATATCTTGGAAAAGACTATATTTTCACTTCTCTATTGCATCTTTCTGACAATCTTAATGTTACAAACATTTTTCTACATTACCAATTGTGCATTGATGCTGATACACTTTTGAAGATTAATAATTAA
Predicted protein sequences of Glyma18g23340
>Glyma18g23340.1   sequence type=predicted peptide   gene model=Glyma18g23340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METLISSGKSDLQKVDPWKACEFFSTCFKDPSTFPVVIVGNIDPIIQSFVLLSPLPHKTFFLLLTLESTSINLDVVDIWSYFGKFNCSQLSNISLISCYAIQVEGAAMSGISPSPYQKFLKSVRPPSIPSYLGKDYIFTSLLHLSDNLNVTNIFLHYQLCIDADTLLKINN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo