|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATMG00480 | AT | Annotation by Michelle Graham. TAIR10: Plant mitochondrial ATPase, F0 complex, subunit 8 protein | chrM:129909-130385 FORWARD LENGTH=158 | SoyBase | E_val: 2.00E-46 | ISS |
| GO:0015986 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport | SoyBase | N/A | ISS |
| GO:0000276 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005753 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0015078 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0046933 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism | SoyBase | N/A | ISS |
| PF02326 | PFAM | Plant ATP synthase F0 | JGI | ISS | |
| UniRef100_E9KZN4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATPase subunit 8 n=1 Tax=Vigna radiata RepID=E9KZN4_VIGRA | SoyBase | E_val: 4.00E-53 | ISS |
| UniRef100_I1NJG0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NJG0_SOYBN | SoyBase | E_val: 3.00E-53 | ISS |
|
Glyma18g23174 not represented in the dataset |
Glyma18g23174 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g145900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g23174.1 sequence type=CDS gene model=Glyma18g23174 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTATGAGGTATCAAGAGTACAAAACAAAAGACTTGAAGTCTTGAAATATAATCATTGTTTCTCAATCAATCATGCCTCAATTGATAAATTCACTTATTTCACACAATTTTTCTGGTCATGCCTTTTCCTCTTTACTTTTTATATTCCCATCAAAGATGGAGATGGAGTACTTGGGATCAGTAGAATTCTAAAACAACCCAACCGACTGGTTTCAAACCGGGGGAACAAAAGAAGGAGAAATGACCCCAAGAGTTTGGAAGATATCTTTAGAAAAGGTTTTAGCACCGGTGTATCCTATTTGTACTCTAGTTTATTCGAAGTATCAAAATGGTGTAACGCCATCGACTCATTGGGAAAAAGGAGGAAAATCACTCTT
>Glyma18g23174.1 sequence type=predicted peptide gene model=Glyma18g23174 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MYEVSRVQNKRLEVLKYNHCFSINHASIDKFTYFTQFFWSCLFLFTFYIPIKDGDGVLGISRILKQPNRLVSNRGNKRRRNDPKSLEDIFRKGFSTGVSYLYSSLFEVSKWCNAIDSLGKRRKITL
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||