SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g22935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g22935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g22935

Feature Type:gene_model
Chromosome:Gm18
Start:26288428
stop:26288849
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17840AT Annotation by Michelle Graham. TAIR10: white-brown complex homolog protein 11 | chr1:6142870-6145894 FORWARD LENGTH=703 SoyBaseE_val: 7.00E-48ISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0015908GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid transport SoyBaseN/AISS
GO:0080051GO-bp Annotation by Michelle Graham. GO Biological Process: cutin transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009897GO-cc Annotation by Michelle Graham. GO Cellular Compartment: external side of plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015245GO-mf Annotation by Michelle Graham. GO Molecular Function: fatty acid transporter activity SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
GO:0042626GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances SoyBaseN/AISS
PTHR19241Panther ATP-BINDING CASSETTE TRANSPORTER JGI ISS
PTHR19241:SF20Panther ABC TRANSPORTER JGI ISS
PF01061PFAM ABC-2 type transporter JGI ISS
UniRef100_Q6X4V5UniRef Annotation by Michelle Graham. Best UniRef hit: ABC transporter n=1 Tax=Gossypium hirsutum RepID=Q6X4V5_GOSHI SoyBaseE_val: 4.00E-52ISS
UniRef100_Q6X4V5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ABC transporter n=1 Tax=Gossypium hirsutum RepID=Q6X4V5_GOSHI SoyBaseE_val: 4.00E-52ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g22935 not represented in the dataset

Glyma18g22935 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g145300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g22935.1   sequence type=CDS   gene model=Glyma18g22935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAATTGGTGGATTCCCTTCATTTGTTGAAGACGTGAAGGTTTTCCAAAGGGAGAGGCTTAATAACCACTATGGTGTCACTTCATTTGTCATCAACAACACATTATTTGCAATGCCCTTCCTAATTTTGACCACCTTTCTCTCTGGAACCATTTGTTACTTCATGATTCGCCTACACCATGGCTTTTGGTACTACCTCTTCTTTGTGTTGTGCCTTTATGCTAGTGTCACAATGGTTGAAAGCTTAATGATGGAAATTGCTAGCATTGTCCCCAACTTCCTCATGGGCGTCATTATTGGAGCAGGGATTTAG

>Glyma18g22935.1   sequence type=predicted peptide   gene model=Glyma18g22935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSIGGFPSFVEDVKVFQRERLNNHYGVTSFVINNTLFAMPFLILTTFLSGTICYFMIRLHHGFWYYLFFVLCLYASVTMVESLMMEIASIVPNFLMGVIIGAGI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo