SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g22860

Feature Type:gene_model
Chromosome:Gm18
Start:26046032
stop:26048016
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g22860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18800AT Annotation by Michelle Graham. TAIR10: NAP1-related protein 2 | chr1:6481466-6483463 REVERSE LENGTH=256 SoyBaseE_val: 7.00E-70ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0010311GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root formation SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003682GO-mf Annotation by Michelle Graham. GO Molecular Function: chromatin binding SoyBaseN/AISS
GO:0042393GO-mf Annotation by Michelle Graham. GO Molecular Function: histone binding SoyBaseN/AISS
PTHR11875Panther NUCLEOSOME ASSEMBLY PROTEIN JGI ISS
PTHR11875:SF47Panther JGI ISS
PF00956PFAM Nucleosome assembly protein (NAP) JGI ISS
UniRef100_I1N1N7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N1N7_SOYBN SoyBaseE_val: 1.00E-83ISS
UniRef100_Q9M9V0UniRef Annotation by Michelle Graham. Most informative UniRef hit: F6A14.10 protein n=1 Tax=Arabidopsis thaliana RepID=Q9M9V0_ARATH SoyBaseE_val: 3.00E-67ISS

Expression Patterns of Glyma18g22860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g22860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g22860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g22860
>Glyma18g22860.2   sequence type=CDS   gene model=Glyma18g22860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCAATGAAGAGGCGAGTGATAAGGTCCTTGAAGTAGAGCAGAAGTACAATGAGATAAGGAAGCCAGTTTACAATAAACGAAATGATGTCGTCAAATCTATTCCTGATTTCTGGTTCACTGCTTTTATGAGTCATCCTGCCCTTTATGAACTTCTGAATGTAGAGGATCAAAAGATATTTATGTATTTGGGTTCTCTTGATGTTGAAGATAATAAAGATGTCAAATCAGGCTACTCAATCACCTTTAATTTCAATCCCAATCCCTATTTTGAGAATATAAAGCTTACAAAGACTTTTACCTTCCTTGAAGAAGGAACAGCAAAGATAACTGCTACCCCCATAAAATGGAAAATGGAAAGAGGGCAAGAATTAATCAAGGATGATTTATGGCCAAATCCACTCACTTATTTCAACAATGTAAGTTAA
Predicted protein sequences of Glyma18g22860
>Glyma18g22860.2   sequence type=predicted peptide   gene model=Glyma18g22860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
INEEASDKVLEVEQKYNEIRKPVYNKRNDVVKSIPDFWFTAFMSHPALYELLNVEDQKIFMYLGSLDVEDNKDVKSGYSITFNFNPNPYFENIKLTKTFTFLEEGTAKITATPIKWKMERGQELIKDDLWPNPLTYFNNVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo