Glyma18g22830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g22830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g22830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g22830

Feature Type:	gene_model
Chromosome:	Gm18
Start:	26033264
stop:	26034059
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g22830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G10840	AT	Annotation by Michelle Graham. TAIR10: translation initiation factor 3 subunit H1 \| chr1:3607885-3609657 REVERSE LENGTH=250	SoyBase	E_val: 2.00E-32	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0006413	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational initiation	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005852	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation initiation factor 3 complex	SoyBase	N/A	ISS
GO:0003743	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity	SoyBase	N/A	ISS
PTHR10410	Panther	JUN ACTIVATION DOMAIN BINDING PROTEIN	JGI		ISS
PTHR10410:SF3	Panther	EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 3	JGI		ISS
UniRef100_A2Q5B8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit n=1 Tax=Medicago truncatula RepID=A2Q5B8_MEDTR	SoyBase	E_val: 4.00E-39	ISS
UniRef100_C6TN20	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TN20_SOYBN	SoyBase	E_val: 2.00E-40	ISS

Expression Patterns of Glyma18g22830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g22830 not represented in the dataset	Glyma18g22830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g22830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g22830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g22830

Limit To All Plant Sequences

>Glyma18g22830.1   sequence type=CDS   gene model=Glyma18g22830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTGTTCTAGCTCTGAAGGCCTTGAAGCTTTCTGACTACTTCATGGAACTCTATTGCAGCAATAATTTTACTGGAGAGAAATTGAGGGAGAAGAACTTATCATGGGTGGATATCTTTGAGGAAATACCAGCACGCTTTCCTAAAATTTTTTCAAATTCTGCCCTTATCAGTGCCTTTATGACAGAGCTGAAACCTGATACTCCATGTGATTATGATCATTTGCAATTGTCAACCAGTTCATTAATGGAGAGGAATACCAATTTTTTTATTTAA

Predicted protein sequences of Glyma18g22830

Limit To All Plant Sequences

>Glyma18g22830.1   sequence type=predicted peptide   gene model=Glyma18g22830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GVLALKALKLSDYFMELYCSNNFTGEKLREKNLSWVDIFEEIPARFPKIFSNSALISAFMTELKPDTPCDYDHLQLSTSSLMERNTNFFI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain