Glyma18g22670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g22670

Feature Type:	gene_model
Chromosome:	Gm18
Start:	25739929
stop:	25740831
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g22670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G33720	AT	Annotation by Michelle Graham. TAIR10: AP2/B3-like transcriptional factor family protein \| chr2:14263776-14264989 FORWARD LENGTH=326	SoyBase	E_val: 9.00E-27	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
UniRef100_I1JWD8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWD8_SOYBN	SoyBase	E_val: 1.00E-120	ISS
UniRef100_I2FKG6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: E1 protein n=1 Tax=Glycine max RepID=I2FKG6_SOYBN	SoyBase	E_val: 7.00E-107	ISS

Proteins Associated with Glyma18g22670

Locus	Gene Symbol	Protein Name
E1	E1-2	E1 gene 2

Expression Patterns of Glyma18g22670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g22670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g143300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g22670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g22670

Limit To All Plant Sequences

>Glyma18g22670.2   sequence type=CDS   gene model=Glyma18g22670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTACAATCACAAATCCCATCAAAGTTTAAAATAATATTCATCTCTTCCAACATGAGCAATCATTCAGATGAGAAGGAGCAGTGTCAAAAGAAGAGGAAATCCACCATATGTGAAGCCTCCAACTTTAGGACATCAAGGAGAAGATTCTGCAGCAACAAAAATGAAGAGGAGATGAACAAGGGAGTTTCAACAACACTGAAGCTTTATGATGACCCTTGGAAGATCAAGAAGACGCTAACCGATAGCGATTTGGGAATCCTAAGTAGACTCTCGCTGGCTACAGATTTGGTGAAGAAGCAAATTTTGCCTATGTTGGGTGCAGATCATGCAAGAGCTGCAGAAACTGAAGAAGGGACCCCAGTTAGAGTTTGGGACATGGACACCAAATCCATGCACCAGCTCGTTCTAAAGCGATGGTCTTCTTCCAAGAGCTATGTTCTTATTGCAAAGTGGAACCAAGATTTCGTGAGAAGAAGAGACCTCAAGAAAGGGGATGAGATCGGATTTCATTGGGATCCATATAATTGCGTTTTCAATTTCTGTGTCCTTAAACGAGCTATGCCAGAGAATTAA

Predicted protein sequences of Glyma18g22670

Limit To All Plant Sequences

>Glyma18g22670.2   sequence type=predicted peptide   gene model=Glyma18g22670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLQSQIPSKFKIIFISSNMSNHSDEKEQCQKKRKSTICEASNFRTSRRRFCSNKNEEEMNKGVSTTLKLYDDPWKIKKTLTDSDLGILSRLSLATDLVKKQILPMLGADHARAAETEEGTPVRVWDMDTKSMHQLVLKRWSSSKSYVLIAKWNQDFVRRRDLKKGDEIGFHWDPYNCVFNFCVLKRAMPEN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain