SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g19720

Feature Type:gene_model
Chromosome:Gm18
Start:21475773
stop:21478836
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G23420AT Annotation by Michelle Graham. TAIR10: Plant-specific transcription factor YABBY family protein | chr1:8317423-8319104 FORWARD LENGTH=231 SoyBaseE_val: 2.00E-71ISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF04690PFAM YABBY protein JGI ISS
UniRef100_G7K086UniRef Annotation by Michelle Graham. Most informative UniRef hit: Axial regulator YABBY n=1 Tax=Medicago truncatula RepID=G7K086_MEDTR SoyBaseE_val: 8.00E-113ISS
UniRef100_UPI000233EB01UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EB01 related cluster n=1 Tax=unknown RepID=UPI000233EB01 SoyBaseE_val: 2.00E-160ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g39290 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g140400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g19720.2   sequence type=CDS   gene model=Glyma18g19720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAACACTGAACCACCTCTTTGATCTTCCAGAACAGATATGCTACGTACAATGTGGATTCTGTACAACAATACTAATGGTGAGCGTTCCATGCAGCATTTTGTCAACAGTGGTGACCGTGAGATGCGGCCACTGCACAAGCCTCCTCTCTGTCAACATGAAGAAAGCTTCCTTGGTCCCTTTCCACCTTCTAGCTTCCCTTACTCATCTTGAGCCAAAAGAAGGTGCTTCAGAAGATGGTGCAAACAAGAGTTTGAGCAGCTATAATACATCCACAATGACCAATTCGGATTGTGAAGAAGAGAACGTGACCCAAATTTCCGATTTCGTGCATAAACCTCCAGAGAAGAGACAAAGAACACCATCTGCTTATAACCGTTTCATCAAAGAAGAGATTAAAAGGCTTAAGGCTGAAAACCCTAACATGGCCCACAAGGAGGCTTTCAGCACTGCGGCAAAAAATTGGGCCAATTTCCCTCCGTCACCGAGTGATGGAGAAGCAGACAGCTGTAACGGGACAGAGCAACTTGTGGATCTGGACTCCCATCAAGAGCCTCGTGATGCAATTGAGGTTGATAAAGAAGGCCAAGGTTTCCGTGGAAGAAAGGCTCCAAGGAATTCTATCTGGGAAAGGACACCTTTTGAGTGA

>Glyma18g19720.2   sequence type=predicted peptide   gene model=Glyma18g19720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTLNHLFDLPEQICYVQCGFCTTILMVSVPCSILSTVVTVRCGHCTSLLSVNMKKASLVPFHLLASLTHLEPKEGASEDGANKSLSSYNTSTMTNSDCEEENVTQISDFVHKPPEKRQRTPSAYNRFIKEEIKRLKAENPNMAHKEAFSTAAKNWANFPPSPSDGEADSCNGTEQLVDLDSHQEPRDAIEVDKEGQGFRGRKAPRNSIWERTPFE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo