Glyma18g19395 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g19395): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g19395): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g19395

Feature Type:	gene_model
Chromosome:	Gm18
Start:	21111260
stop:	21111978
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g19395

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13420	AT	Annotation by Michelle Graham. TAIR10: Aldolase-type TIM barrel family protein \| chr5:4302080-4304212 REVERSE LENGTH=438	SoyBase	E_val: 6.00E-43	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0009060	GO-bp	Annotation by Michelle Graham. GO Biological Process: aerobic respiration	SoyBase	N/A	ISS
GO:0009809	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process	SoyBase	N/A	ISS
GO:0033587	GO-bp	Annotation by Michelle Graham. GO Biological Process: shikimate biosynthetic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004801	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity	SoyBase	N/A	ISS
PF00923	PFAM	Transaldolase	JGI		ISS
UniRef100_A6MZF0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transaldolase 2 (Fragment) n=1 Tax=Oryza sativa Indica Group RepID=A6MZF0_ORYSI	SoyBase	E_val: 4.00E-47	ISS
UniRef100_I1N1H6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N1H6_SOYBN	SoyBase	E_val: 2.00E-90	ISS

Expression Patterns of Glyma18g19395

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g19395 not represented in the dataset	Glyma18g19395 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g19395 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g139200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g19395

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g19395

Limit To All Plant Sequences

>Glyma18g19395.1   sequence type=CDS   gene model=Glyma18g19395   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCTTTCTAGAGTTACAAGTGTTGCCTCTTTCTTCGTCAGCAGAGTGGACACTCTTATTGACAAGGCCCTTGAGAAAATTGGCACCCTCAGAGGCTCTTAATCTACGTGGGAAAGTAGCAGTAGCCCAAGCAGCATTGGCTTACCAGCTCTACCAAAGGAAATTTTATAGTCCAAGGTGGGAAGTTCTAGTTAAAAAGGGGACCAAGAACCAAAGGCTCCTCTCGGTCTCAACCAATGTAAAGAACCCTGCCTATTCTGACACCTTATATGTTGCTTCTCTTATTGGACCTAACACTCAATACCTTGTTACTTTCCATCTATCAACCATGCCAGACCAAGCCCTTCAAACATTTATTGATCATGGTACCGTATCCTGGACAATAGACTCAAATGCATCTGAAGCTGAAGGAATATACAATGCTTTCCATTTGGTGTTAATAGTTTAA

Predicted protein sequences of Glyma18g19395

Limit To All Plant Sequences

>Glyma18g19395.1   sequence type=predicted peptide   gene model=Glyma18g19395   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTFLELQVLPLSSSAEWTLLLTRPLRKLAPSEALNLRGKVAVAQAALAYQLYQRKFYSPRWEVLVKKGTKNQRLLSVSTNVKNPAYSDTLYVASLIGPNTQYLVTFHLSTMPDQALQTFIDHGTVSWTIDSNASEAEGIYNAFHLVLIV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain