Glyma18g19370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g19370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g19370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g19370

Feature Type:	gene_model
Chromosome:	Gm18
Start:	21100105
stop:	21103628
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g19370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G12370	AT	Annotation by Michelle Graham. TAIR10: exocyst complex component sec10 \| chr5:4003002-4008445 REVERSE LENGTH=820	SoyBase	E_val: 4.00E-29	ISS
GO:0006887	GO-bp	Annotation by Michelle Graham. GO Biological Process: exocytosis	SoyBase	N/A	ISS
GO:0007015	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament organization	SoyBase	N/A	ISS
GO:0048278	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle docking	SoyBase	N/A	ISS
GO:0000145	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: exocyst	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF07393	PFAM	Exocyst complex component Sec10	JGI		ISS
UniRef100_G7L9W0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Exocyst complex component n=1 Tax=Medicago truncatula RepID=G7L9W0_MEDTR	SoyBase	E_val: 1.00E-30	ISS
UniRef100_I1MK77	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MK77_SOYBN	SoyBase	E_val: 5.00E-33	ISS

Expression Patterns of Glyma18g19370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g19370 not represented in the dataset	Glyma18g19370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g19370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g19370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g19370

Limit To All Plant Sequences

>Glyma18g19370.1   sequence type=CDS   gene model=Glyma18g19370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGCAGAAAGTCTAGCTTTTTTCTCCAACCTTAGGCATGAACTAACAACAAATAGCATACGGCAGGAGGGCAAGGCCATCAATCGCCATTATTTTTTTTCATTCCCCCTTTCCCCTTGTTCTACTAATTTATTGCTCAAAGATTGTGATCTGTCACAAGTTCCTGCATGGTTTTGTTCATGGGATCTCAACAATTCACATTACATATATGTTGGACTACAGGTCAGCACTTTGGTTTTGTATTTATTTGATGTGGGAACTTCAAATGCTAATCTTCATATAACTTCCTCGCAGAATGTGTACCCACTAACATATCAAATGTTGAATTTTTGGGTTACAAGTGCCATGCAACATTATGTGGCAACACGTCCAATGTTCATTGATGCTGTCCAAGCTAGTCCTAGTAATGTTGCTCGTGGGCTTTCCTCCTTGTACAAAGAAATCATAGATACTGTTCGTAAAGAAGCTACAACAATCACGACCGTATTCCCTTCACCAAGTGAAGTTATGTCAATTTTAGTTCAGGTTGTATATTTTATTGTGTTCACAAAAACCAATGTTCTCATAATTCTGCATGCAGAGAAGAAACCATCTCTTGTCAATTTACCTTCCGTGGAGGAAGGTGGGCTCCTATTAATGATTCTTGCTTCATGGCAACTTTCAAGCAGGACATTTGACTCTATTAATTTTATGTACCTTACCCATATTATAAATATGTGCAAGGCAAGGTTTAGGAGGGTCATAGTCTTTCTAGTTAGGCTCTCAAATTGGCACCCTAGAATTGTCTTCTTATTAGAGGTGTTCGTGTTAACATATTTACCTACAGTTGAAGATGATAGATGTAAAACCTATAGTGACAGACAATTAGCCGTCATTATATGCCCCCTCAAAGTTGATGGAAGAAACGTCTGTAGGACAAAAGTTACAAAAACTTTATTTTATACGGATTGTATCTCAAAACTTTTCATAAACCGAACTCAATCAATACTTAATCAATCCACCCTTCACACAAGATCTTTCATTAAAAGAAGCTAA

Predicted protein sequences of Glyma18g19370

Limit To All Plant Sequences

>Glyma18g19370.1   sequence type=predicted peptide   gene model=Glyma18g19370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHAESLAFFSNLRHELTTNSIRQEGKAINRHYFFSFPLSPCSTNLLLKDCDLSQVPAWFCSWDLNNSHYIYVGLQVSTLVLYLFDVGTSNANLHITSSQNVYPLTYQMLNFWVTSAMQHYVATRPMFIDAVQASPSNVARGLSSLYKEIIDTVRKEATTITTVFPSPSEVMSILVQVVYFIVFTKTNVLIILHAEKKPSLVNLPSVEEGGLLLMILASWQLSSRTFDSINFMYLTHIINMCKARFRRVIVFLVRLSNWHPRIVFLLEVFVLTYLPTVEDDRCKTYSDRQLAVIICPLKVDGRNVCRTKVTKTLFYTDCISKLFINRTQSILNQSTLHTRSFIKRS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain