Glyma18g18961 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g18961

Feature Type:	gene_model
Chromosome:	Gm18
Start:	20545790
stop:	20553386
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g18961

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G60230	AT	Annotation by Michelle Graham. TAIR10: Radical SAM superfamily protein \| chr1:22212223-22214346 REVERSE LENGTH=458	SoyBase	E_val: 1.00E-123	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0008173	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA methyltransferase activity	SoyBase	N/A	ISS
GO:0051536	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding	SoyBase	N/A	ISS
UniRef100_D7KXB2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Radical SAM domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KXB2_ARALL	SoyBase	E_val: 2.00E-121	ISS
UniRef100_I1KXG4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KXG4_SOYBN	SoyBase	E_val: 1.00E-157	ISS

Expression Patterns of Glyma18g18961

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g18961 not represented in the dataset	Glyma18g18961 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g18961

Paralog	Evidence	Comments
Glyma08g39710	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g18961 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g137800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g18961

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g18961

Limit To All Plant Sequences

>Glyma18g18961.1   sequence type=CDS   gene model=Glyma18g18961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGGGTTCAAGAGTTTGAATAAAGATTTCAAGAAAATGTTGAATGAAAATGCTGAGTTCAAAGCGCTTGCTCTAAAAGAAATTCGCACAGCATCTGATGGAATAAGAAAGATTTTATTCACATTGGATGATGGGCTGGTCATAGAAACAGTTGTCATACTTTGTGACAGAGGTAGGACTACTGTGTGTGTTTCAAGTCAAGTTGGATGTGCCATGAATTGTAAATTTTGCTACACTGGAAGAATGGGTCTTCGGAGACATCTTACTGCTGCAGAAATAGGCATGGGGGAACCACTTCATAACACTGATAATGTCATTAAAGCTGCATATATAATGGTGGATGAGCAAGGGCTTTATGGGCTTATTCCACAGCTCAAACGTTTCCTCCATGAATCGAACTGTGCATTAGCTTACAAGCTGGACTTGCTTCTTCAGACACTTCGAGAGGAGCTTTGCTTCAAAAAGAACTACAAAGTTCTATTTGAGCATGTGATGCTTGAAGGAATTAATGATAGGATGGCTAAACTTTACTTTGATGTAGAGAGGCTTATCGAGCTTGTGAAGGGAATTTCTTGCAAGATTAATCTAATCTCATTCAATCCGCACAGTGGATCATTCTTCAAACCAACCAAATATGAAAGGATGATTGAATTCCGAAATACATTGGCTGGGGCAGGATTGATAGTATTTTTAAGACTTAGTAGAGGTGATGATCAATTGGCTTCCTGTGGTCAATTGGGTAAGCCTGGCACCATTCAAGCTCCATTGCTTCGTGTACCAGAGCAATTCCAAATGGCAATTGGAAGTTCAACTTGA

Predicted protein sequences of Glyma18g18961

Limit To All Plant Sequences

>Glyma18g18961.1   sequence type=predicted peptide   gene model=Glyma18g18961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGFKSLNKDFKKMLNENAEFKALALKEIRTASDGIRKILFTLDDGLVIETVVILCDRGRTTVCVSSQVGCAMNCKFCYTGRMGLRRHLTAAEIGMGEPLHNTDNVIKAAYIMVDEQGLYGLIPQLKRFLHESNCALAYKLDLLLQTLREELCFKKNYKVLFEHVMLEGINDRMAKLYFDVERLIELVKGISCKINLISFNPHSGSFFKPTKYERMIEFRNTLAGAGLIVFLRLSRGDDQLASCGQLGKPGTIQAPLLRVPEQFQMAIGSST*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain