Report for Sequence Feature Glyma18g18491
Feature Type: gene_model
Chromosome: Gm18
Start: 19900922
stop: 19917229
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g18491
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G23900 AT
Annotation by Michelle Graham. TAIR10: gamma-adaptin 1 | chr1:8441379-8447152 FORWARD LENGTH=876
SoyBase E_val: 1.00E-43 ISS
GO:0006886 GO-bp
Annotation by Michelle Graham. GO Biological Process: intracellular protein transport
SoyBase N/A ISS
GO:0015031 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein transport
SoyBase N/A ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0030117 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane coat
SoyBase N/A ISS
GO:0030121 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: AP-1 adaptor complex
SoyBase N/A ISS
GO:0030131 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: clathrin adaptor complex
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0008565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein transporter activity
SoyBase N/A ISS
GO:0030276 GO-mf
Annotation by Michelle Graham. GO Molecular Function: clathrin binding
SoyBase N/A ISS
PTHR22780 Panther
ADAPTIN, ALPHA/GAMMA/EPSILON
JGI ISS
PTHR22780:SF5 Panther
ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA SUBUNIT (GAMMA-ADAPTIN)
JGI ISS
PF01602 PFAM
Adaptin N terminal region
JGI ISS
UniRef100_G5DWC2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AP-1 complex subunit gamma-1 (Fragment) n=1 Tax=Silene latifolia RepID=G5DWC2_SILLA
SoyBase E_val: 6.00E-43 ISS
UniRef100_I1KXI7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXI7_SOYBN
SoyBase E_val: 2.00E-46 ISS
Expression Patterns of Glyma18g18491
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g18491
Paralog Evidence Comments
Glyma08g39930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g18491 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g135400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g18491
Coding sequences of Glyma18g18491
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g18491.1 sequence type=CDS gene model=Glyma18g18491 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGCGGGTTACACTAACACCAACTCCATTTCCAAGCACCGCGATTTATTTTATTTTATTTTCCTCTTTTTCATTTCGTTTTCCGAAAAAAACTCAGACAGCATAGAAGCGAAGCAAAACAAATCAAAACAACTTTCGCATAACGCATTGCATTGCGATTGTTGCAATTGGAAGAAGGAAAAAGAAAAATTTCAGAGACTCACACAACAGACGCCACTGTCAGATCCAAATCGGTTTCCACTCTCAGATCCGAATTCAGTCAAACTGGATCCGCTTGAGTTTCCAAACATGAACCCCTTCTCTTCTCCCTCGCGTTTGAGGGACATGATTCAGGCCATACGTGCTTGCAAAACTGCAGCAGAAGAACGTGCTGTTGTAAGAAAAGAATGTGCTACCATTCACGCTGCAATAGATGAAAATGATCCAGACTATAGGCACTGGAATCTGGCTAAGCTAATGTTCATCCACATGCTTGGCTACCCCACTCATTTTGGTCAAATGGAGTGCCTCAAGTTGATAGCATCTCCTGGATTTCCATAG
Predicted protein sequences of Glyma18g18491
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g18491.1 sequence type=predicted peptide gene model=Glyma18g18491 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAAGYTNTNSISKHRDLFYFIFLFFISFSEKNSDSIEAKQNKSKQLSHNALHCDCCNWKKEKEKFQRLTQQTPLSDPNRFPLSDPNSVKLDPLEFPNMNPFSSPSRLRDMIQAIRACKTAAEERAVVRKECATIHAAIDENDPDYRHWNLAKLMFIHMLGYPTHFGQMECLKLIASPGFP*