Glyma18g17490 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g17490

Feature Type:	gene_model
Chromosome:	Gm18
Start:	18772042
stop:	18774829
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g17490

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75750	AT	Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 1 \| chr1:28441813-28442284 REVERSE LENGTH=98	SoyBase	E_val: 4.00E-21	ISS
GO:0000271	GO-bp	Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0006569	GO-bp	Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process	SoyBase	N/A	ISS
GO:0009684	GO-bp	Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009741	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0009932	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell tip growth	SoyBase	N/A	ISS
GO:0010817	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels	SoyBase	N/A	ISS
GO:0043481	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02704	PFAM	Gibberellin regulated protein	JGI		ISS
UniRef100_G7LER1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein n=1 Tax=Medicago truncatula RepID=G7LER1_MEDTR	SoyBase	E_val: 1.00E-52	ISS
UniRef100_UPI000004A1B7	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000004A1B7 related cluster n=1 Tax=unknown RepID=UPI000004A1B7	SoyBase	E_val: 2.00E-77	ISS

Expression Patterns of Glyma18g17490

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g17490

Paralog	Evidence	Comments
Glyma08g40260	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g17490 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g132100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g17490

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma18g17490

Limit To All Plant Sequences

>Glyma18g17490.2   sequence type=transcript   gene model=Glyma18g17490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCACAGCCTTGAAATGGTACTCAACATTTGCAGGTCCTCCTCATATACAGTACACACTTCAGCTGGTAGATAGTGCTTCCAAATGGAGAAGAAAAGGAAGACTTTACTATTGCTGCTGCTCATGGCTGCAACTCTCTTCTGCATGCCAATTGTGTCGTATGCTGTTTCTAGTGTCAACATTCAAGGTCATCTCACCCATTCTGAGCTGGTAAAAGGTCCCAATAGAAGGCTTTTGCCATTTGTGGATTGTGGAGCGAGGTGCAGGGTGAGGTGCAGTTTGCACTCAAGGCCAAAAATTTGCTCAAGAGCTTGCGGGACATGCTGTTTCAGGTGCAGGTGTGTTCCTCCAGGCACTTACGGGAACAGAGAGATGTGTGGCAAGTGTTACACTGACATGATCACTCATGGCAACAAACCTAAGTGCCCCTAAACCTGTGCATGCATGCCCATGTGTGTCTACACCTTATGATGTTTATCACTAGTTAACACAAATTTGAATTCCCATTTTTTTGTTTTTTCTACCTTAATTTCTTAATGCATTGTGTTTCTCATAATTTGTAACCATCAGTTTTGTGTTTTTTTTCTTCTGAACATCATCAGTTTTGTGTATTGCTGCGATTTAATGCATCTATATATAATGCATCAGTTGTTTTTATTTTTTTAATTTGGTTATGTATGCATCAGTT

Coding sequences of Glyma18g17490

Limit To All Plant Sequences

>Glyma18g17490.1   sequence type=CDS   gene model=Glyma18g17490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGTTTCTAGTGTCAACATTCAAGCTGGTAAAAGGTCCCAATAGAAGGCTTTTGCCATTTGTGGATTGTGGAGCGAGGTGCAGGGTGAGGTGCAGTTTGCACTCAAGGCCAAAAATTTGCTCAAGAGCTTGCGGGACATGCTGTTTCAGGTGCAGGTGTGTTCCTCCAGGCACTTACGGGAACAGAGAGATGTGTGGCAAGTGTTACACTGACATGATCACTCATGGCAACAAACCTAAGTGCCCCTAA

>Glyma18g17490.2   sequence type=CDS   gene model=Glyma18g17490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAGAAAAGGAAGACTTTACTATTGCTGCTGCTCATGGCTGCAACTCTCTTCTGCATGCCAATTGTGTCGTATGCTGTTTCTAGTGTCAACATTCAAGGTCATCTCACCCATTCTGAGCTGGTAAAAGGTCCCAATAGAAGGCTTTTGCCATTTGTGGATTGTGGAGCGAGGTGCAGGGTGAGGTGCAGTTTGCACTCAAGGCCAAAAATTTGCTCAAGAGCTTGCGGGACATGCTGTTTCAGGTGCAGGTGTGTTCCTCCAGGCACTTACGGGAACAGAGAGATGTGTGGCAAGTGTTACACTGACATGATCACTCATGGCAACAAACCTAAGTGCCCCTAA

Predicted protein sequences of Glyma18g17490

Limit To All Plant Sequences

>Glyma18g17490.1   sequence type=predicted peptide   gene model=Glyma18g17490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLFLVSTFKLVKGPNRRLLPFVDCGARCRVRCSLHSRPKICSRACGTCCFRCRCVPPGTYGNREMCGKCYTDMITHGNKPKCP*

>Glyma18g17490.2   sequence type=predicted peptide   gene model=Glyma18g17490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKKRKTLLLLLLMAATLFCMPIVSYAVSSVNIQGHLTHSELVKGPNRRLLPFVDCGARCRVRCSLHSRPKICSRACGTCCFRCRCVPPGTYGNREMCGKCYTDMITHGNKPKCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain