SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g17214

Feature Type:gene_model
Chromosome:Gm18
Start:18283436
stop:18285657
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G24190AT Annotation by Michelle Graham. TAIR10: SIN3-like 3 | chr1:8563858-8569927 REVERSE LENGTH=1330 SoyBaseE_val: 6.00E-37ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PTHR12346Panther SIN3B-RELATED JGI ISS
PF02671PFAM Paired amphipathic helix repeat JGI ISS
UniRef100_B9HU88UniRef Annotation by Michelle Graham. Most informative UniRef hit: SIN3 component, histone deacetylase complex n=1 Tax=Populus trichocarpa RepID=B9HU88_POPTR SoyBaseE_val: 3.00E-40ISS
UniRef100_UPI00023386B1UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023386B1 related cluster n=1 Tax=unknown RepID=UPI00023386B1 SoyBaseE_val: 3.00E-72ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g17214 not represented in the dataset

Glyma18g17214 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g40420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g130300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g17214.1   sequence type=CDS   gene model=Glyma18g17214   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGATAGTGCCTTAGCATATCTCTCCACAGTCAAGGATGCATTTAAAGATGATAGAGAAAAATTTGATAAATTTTTGGAACTCATGAAAAATTTCACTGCTGATAGATTCAACCTTGTTAGTGGCATAGAAGAAGTGAAGGAGCTGCTTAAAGGGCATAGAGATCTAATTTTTGGATTTAATGTTTTCTTGCCGAAGGGATTTGAAATCAAACTTCCATTGGAGGATGAACAACCTCCACAGAAGAAGCTTGATGTGTTTGTTGAAGCTAAAAAAATTATGCACAAGATTGAGACTCGGTTCCATGGCCAAGATAATGTCTACAAGGCATTTCTAGCCATATTGAAGATGCACAAAGACGGAAACAGGACTCCCCTGCAGCTTACGAGGAGGACCATGTGGATCTTCTAA

>Glyma18g17214.1   sequence type=predicted peptide   gene model=Glyma18g17214   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADSALAYLSTVKDAFKDDREKFDKFLELMKNFTADRFNLVSGIEEVKELLKGHRDLIFGFNVFLPKGFEIKLPLEDEQPPQKKLDVFVEAKKIMHKIETRFHGQDNVYKAFLAILKMHKDGNRTPLQLTRRTMWIF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo