SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g17143): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g17143): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g17143

Feature Type:gene_model
Chromosome:Gm18
Start:17984799
stop:17987970
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70000AT Annotation by Michelle Graham. TAIR10: myb-like transcription factor family protein | chr1:26363674-26364635 REVERSE LENGTH=261 SoyBaseE_val: 2.00E-55ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR25040Panther FAMILY NOT NAMED JGI ISS
PTHR25040:SF29Panther SUBFAMILY NOT NAMED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_Q0PJB3UniRef Annotation by Michelle Graham. Best UniRef hit: MYB transcription factor MYB149 n=1 Tax=Glycine max RepID=Q0PJB3_SOYBN SoyBaseE_val: 3.00E-118ISS
UniRef100_Q0PJB3UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB149 n=1 Tax=Glycine max RepID=Q0PJB3_SOYBN SoyBaseE_val: 3.00E-118ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g17143 not represented in the dataset

Glyma18g17143 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g129900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g17143.1   sequence type=CDS   gene model=Glyma18g17143   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTTCCGCAGAGAAGGACGGGATCATGCTCTTCGGCGTGCGCCTCACCGTATCGGATAATAACCCTACAACCTTAAGGAAGAGCGCCAGCATGAACAATCTCTCCCAATACGACTCTCAACCACCGCACGATCCCAACGCAGGGTACGCCTCAGACGATGTCGTTCATCCCTCCCGTCACACCCGAGAACGCAAACGAGGTGTTCCGTGGACGGAGGAAGAACACAGGTTGTTCCTGTTGGGATTACAGAACGTTGGAAAAGGAAATTGGAGAGGAATTTCTAGAAACTTCGTGATGACTCGAACCCCGACACAGGTTGCTAGTCATGCTCAGAAGTACTTCCTCCGCTGCCACAGGCAGAACCGCCGCCGCCGGAGATCTAGTCTCTTCGACATCACCACCAACTCGGTGATGGAACCGTGGCCGGAGAAGGAAGAGGAACAAGCGGCGGCGCCATCTACTAGGTTGAAACCGGTTCTGCCGGTGCCTCAGTCGTCGAAGATGGCAGAGTTGGACTTGAATGGGAAGTCGCTGTCGCTGAAGCTTTCGGTATCCAAGCCACCTATTTCTAATGAGAATTTTGGCGGTGGTGGGGATAGCATTAGCAGTGTTGCTTGA

>Glyma18g17143.1   sequence type=predicted peptide   gene model=Glyma18g17143   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCSAEKDGIMLFGVRLTVSDNNPTTLRKSASMNNLSQYDSQPPHDPNAGYASDDVVHPSRHTRERKRGVPWTEEEHRLFLLGLQNVGKGNWRGISRNFVMTRTPTQVASHAQKYFLRCHRQNRRRRRSSLFDITTNSVMEPWPEKEEEQAAAPSTRLKPVLPVPQSSKMAELDLNGKSLSLKLSVSKPPISNENFGGGGDSISSVA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo