Glyma18g16950 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g16950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g16950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g16950

Feature Type:	gene_model
Chromosome:	Gm18
Start:	17679046
stop:	17681817
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g16950

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G59820	AT	Annotation by Michelle Graham. TAIR10: aminophospholipid ATPase 3 \| chr1:22011599-22020023 FORWARD LENGTH=1213	SoyBase	E_val: 2.00E-93	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006812	GO-bp	Annotation by Michelle Graham. GO Biological Process: cation transport	SoyBase	N/A	ISS
GO:0006820	GO-bp	Annotation by Michelle Graham. GO Biological Process: anion transport	SoyBase	N/A	ISS
GO:0006862	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0015696	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transport	SoyBase	N/A	ISS
GO:0015802	GO-bp	Annotation by Michelle Graham. GO Biological Process: basic amino acid transport	SoyBase	N/A	ISS
GO:0015914	GO-bp	Annotation by Michelle Graham. GO Biological Process: phospholipid transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0043269	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of ion transport	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0048194	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle budding	SoyBase	N/A	ISS
GO:0048364	GO-bp	Annotation by Michelle Graham. GO Biological Process: root development	SoyBase	N/A	ISS
GO:0048367	GO-bp	Annotation by Michelle Graham. GO Biological Process: shoot development	SoyBase	N/A	ISS
GO:0048527	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root development	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0004012	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phospholipid-translocating ATPase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0005548	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phospholipid transporter activity	SoyBase	N/A	ISS
GO:0015662	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
PTHR24092	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24092:SF18	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00122	PFAM	E1-E2 ATPase	JGI		ISS
UniRef100_Q9XIE6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phospholipid-transporting ATPase 3 n=1 Tax=Arabidopsis thaliana RepID=ALA3_ARATH	SoyBase	E_val: 1.00E-90	ISS
UniRef100_UPI000233E167	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E167 related cluster n=1 Tax=unknown RepID=UPI000233E167	SoyBase	E_val: 8.00E-103	ISS

Expression Patterns of Glyma18g16950

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g16950 not represented in the dataset	Glyma18g16950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g16950 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g129100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g16950

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g16950

Limit To All Plant Sequences

>Glyma18g16950.1   sequence type=CDS   gene model=Glyma18g16950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGTCCTGTGTCTCCAATAACTAATGTGCTTCCTCTATCTCTGGTGCTTCTTGTCTCTCTTATTAAGGAAGCTTTTGAGGACTGGAAGCGTTTTCAAAATGACATGTCTGTAAACAATAATACAATAGATGTTTTGCAAGATCAAAAGTGGGGGTCTATACCCTGGAAAAAGTTGCAGGTTGGAGACCTTGTTAAGGTTAAGCAGGATGCATTCTTTCCTGCAGATCTGCTTTTCTTGGCTAGCACTAATGCAGATGGTGTCTGCTACATTGAGACTGCTAATTTGGATGGGGAAACAAATTTGAAGATTAGGAAAGCATTGGAAAAGACTTGGGATTACGTGACTCCAGAGAAGGCATCTGAGTTTAAAGGTGAAATTCAATGTGAACAACCAAACAATTCATTGTATACCTTTACTGGAAATCTTATAACTCAAAAGCAAACACTGCCTCTCAGTCCAAATCAAATTTTGTTGCGG

Predicted protein sequences of Glyma18g16950

Limit To All Plant Sequences

>Glyma18g16950.1   sequence type=predicted peptide   gene model=Glyma18g16950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SPVSPITNVLPLSLVLLVSLIKEAFEDWKRFQNDMSVNNNTIDVLQDQKWGSIPWKKLQVGDLVKVKQDAFFPADLLFLASTNADGVCYIETANLDGETNLKIRKALEKTWDYVTPEKASEFKGEIQCEQPNNSLYTFTGNLITQKQTLPLSPNQILLR

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain